KEGG   Mycolicibacterium vanbaalenii: Mvan_4921Help
Entry
Mvan_4921         CDS       T00449                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Mvan_4921
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     Mvan_4921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Shikimate_DH F420_oxidored 3HCDH_N Sacchrp_dh_NADP THF_DHG_CYH_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABM15694
UniProt: A1TEU4
Position
5270948..5271769
Genome map
AA seq 273 aa AA seqDB search
MTRGRQREANVILDRFRLDDQVAVVTGAGRGLGAAMALAFAEAGADVLIAARTRSQLEEV
AEQIEGTGRRAHIVVADLAHAEDTAALAAGAVEAFGRLDIVVNNVGGTMPNALLTTSTKD
MRDAFAFNVATAHALTTAAVPLMLEHSGGGSIINITSTMGRLAGRGFAAYGTAKAALAHY
TRLSALDLAPRIRVNAIAPGSILTSALEIVADNDELRGPMEKATPLRRLGDPLDIAAAAV
YLASPAGSYLTGKTLEVDGGITFPNLDLPIPDL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcggcaggcaacgggaggcgaatgtgattctggaccggttccgactcgacgat
caggtggccgtggtgaccggcgcgggccgcgggctcggcgccgcgatggccctcgcgttc
gccgaagcaggcgctgacgtgctgattgcggcgcgcacgcggtcacagctcgaagaggtc
gccgaacagatcgaaggcaccgggaggcgcgcccacatcgtcgtcgccgacctcgcccac
gccgaggacacggccgccttggcggccggcgccgtcgaggccttcggcagactagacatc
gtcgtcaacaacgtcggcggcaccatgccgaacgcgcttctcaccacgtcgacgaaggac
atgcgcgacgcgttcgcgttcaacgtcgcgaccgcccacgcgctgaccaccgccgcagtc
ccgctgatgctcgagcactccggcggcggcagcatcatcaacatcacctcgacgatgggc
cgcctggccgggcgcgggttcgccgcctacggcaccgccaaagccgcgctggcgcactac
acccgactgtcggcgctcgatctggcgccgcggatccgggtgaacgcgatcgcgcccggc
tcgatcctgacctcggcactggagatcgtcgccgacaacgacgagttgcgcggcccgatg
gagaaggccacaccgctgcggcggctcggcgacccgctcgacatcgccgcggcagcggtc
tatctggcctctccggcgggcagttatctcaccggcaagaccctcgaggtcgacggcggg
atcaccttcccgaacctcgacctcccgatccccgacctgtaa

DBGET integrated database retrieval system