KEGG   Mycolicibacterium vanbaalenii: Mvan_5067Help
Entry
Mvan_5067         CDS       T00449                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00071  Fatty acid degradation
mva00072  Synthesis and degradation of ketone bodies
mva00280  Valine, leucine and isoleucine degradation
mva00310  Lysine degradation
mva00362  Benzoate degradation
mva00380  Tryptophan metabolism
mva00620  Pyruvate metabolism
mva00630  Glyoxylate and dicarboxylate metabolism
mva00640  Propanoate metabolism
mva00650  Butanoate metabolism
mva00900  Terpenoid backbone biosynthesis
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01200  Carbon metabolism
mva01212  Fatty acid metabolism
mva02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mvan_5067
   00630 Glyoxylate and dicarboxylate metabolism
    Mvan_5067
   00640 Propanoate metabolism
    Mvan_5067
   00650 Butanoate metabolism
    Mvan_5067
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mvan_5067
   00072 Synthesis and degradation of ketone bodies
    Mvan_5067
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mvan_5067
   00310 Lysine degradation
    Mvan_5067
   00380 Tryptophan metabolism
    Mvan_5067
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mvan_5067
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_5067
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mvan_5067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mva04147]
    Mvan_5067
Enzymes [BR:mva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mvan_5067
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mvan_5067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABM15838
UniProt: A1TF88
Position
complement(5435688..5436899)
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQRNGALNEIKPVNLVVGLIDEMRVRFPDLDENLISDLILGCVS
PVGDQGGDIARTAGLVAGLPDTTGGFQLNRFCASGLEAVNLGAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAWAGDPETNYRIGFVPQGIGADLIATIEGFSREDVDAYAARSQERAAA
AWAGGYFAKSVVPVKDQNGLVVLDHDEHMRPGSTVESLGKLKTAFDGIGAMGGFDDVALQ
KYHFVEKINHVHTGGNSSGIVDGAALLLIGSEAAGKSQGLTPRARIVATATSGADPVIML
TGPTPATQKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMITGTMVDELERRGAKRALMTLCVGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaagcgatccgcaccccccgcggcaagcagagaaac
ggcgccctgaacgagatcaagccggtgaaccttgtcgtcggcctgatcgacgagatgcgc
gtccgcttccctgacctcgacgagaacctgatcagcgacctcatcctgggttgcgtctcg
cccgtcggcgaccagggcggagacatcgcccgcaccgccggcctggtggccggcctgccg
gacaccaccggtggcttccagctcaaccggttctgcgcctccggcctggaagcggtcaac
ctgggcgcccagaaggtgcggtcgggctgggacgacctggtgctcgccggcggcgtggag
tcgatgagccgcgtcccgatggggtccgacggcggcgcctgggccggcgatcccgagacc
aactaccggatcgggttcgtcccacagggcatcggcgcggacctgatcgccaccatcgag
ggcttctcccgcgaggacgtcgacgcctacgcggcgcggtcgcaggagcgtgccgcggca
gcctgggcgggcggctacttcgccaagtccgtggtgccggtcaaggatcagaacggcctg
gtcgtgctggaccatgacgagcacatgcgtcccggttccaccgtggagagcctgggcaag
ctcaagaccgcgttcgacggtatcggcgcgatgggcggcttcgacgatgtggcgctgcag
aagtaccacttcgtcgagaagatcaaccacgtccacaccggcgggaacagctcgggcatc
gtcgacggcgccgccctgctgctcatcggcagcgaggccgcgggcaagtcgcaggggctg
accccgcgggcgcgcatcgtcgccaccgcgaccagcggcgccgatccggtcatcatgctg
accggtccgaccccggccacccagaaggtgctcgaccgggccgggctgaccgtcgacgac
atcgacctgttcgaactgaacgaggccttcgcctcggtggtgctcaagttccagaaggat
ctgaacatcccggacgagaagctcaacgtcaacggtggcgccatcgcgatgggtcacccg
ctgggcgccaccggcgccatgatcaccggaaccatggtcgacgagctcgagcgtcgtggc
gcgaagcgtgcgctgatgacgctgtgtgtcggcggcggcatgggcgtggccaccatcatc
gagcgagtctga

DBGET integrated database retrieval system