KEGG   Mycolicibacterium vanbaalenii: Mvan_5450Help
Entry
Mvan_5450         CDS       T00449                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00010  Glycolysis / Gluconeogenesis
mva00071  Fatty acid degradation
mva00350  Tyrosine metabolism
mva00625  Chloroalkane and chloroalkene degradation
mva00626  Naphthalene degradation
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_5450
  Lipid metabolism
   00071 Fatty acid degradation
    Mvan_5450
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mvan_5450
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mvan_5450
   00626 Naphthalene degradation
    Mvan_5450
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mvan_5450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 NAD_binding_10 TrkA_N Glu_dehyd_C ELFV_dehydrog NAD_binding_3 ApbA
Motif
Other DBs
NCBI-ProteinID: ABM16220
UniProt: A1TGC0
Position
5831852..5832922
Genome map
AA seq 356 aa AA seqDB search
MKMRAARMYGYKQPLRLEEVDVPSPGPEEVLVRVGGAGMCRTDFQLIDGYFDNGLSMDFP
ITPGHEVAGWVDGVGSAVPKSAGLAEGDQVVVFGSWGDGACRQCHEGNEQLCAHGVWAGF
GRHGGYQEYLPVNYRYLIKIPGGGELSPDNLAPLTDAGLTPYRGLKKLRNAGHLGPGRTV
AVSGIGGLGSYATQYAKLLGGGAEVVAFARSDEKLKIAKDNGADHVVNVRDKDTEDVRAE
LESATGRTELDAVIECAGSEDSIRLAFSLLAAEGAVASVGLIGNRVDIPLFPLVAREYTF
YGSFWGNYNDLTEVLALARTGQLKHSVTRVRFDDVNETLEAIARGDVLGRAVIVYD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcgggccgcccgcatgtacgggtacaagcagccactgcgcctcgaagaggtc
gatgtgccgtctcccggtcccgaggaggtgctcgtccgggtgggcggtgcgggcatgtgc
cgcactgacttccagctgatcgacggctatttcgacaacggtctttcgatggactttccc
atcacgcccggacacgaggtcgccggctgggtcgacggagtcggatcggcggttccgaag
tcggcggggctggcggagggcgatcaggtggtggtgttcggcagctggggcgatggggcg
tgcaggcaatgtcacgaaggcaacgagcagctgtgcgcgcacggcgtctgggcgggcttc
ggccgccacggcggctatcaggagtacctgcccgtcaactaccggtacctgatcaagatc
cccggcgggggtgaactgtcgccggacaacctggcgccgctgacagacgccgggctgacg
ccctaccgggggttgaagaagttgcgcaacgcggggcacctcgggcccggcaggaccgtc
gcggtgtcgggaatcggcggcctggggagttacgccacgcagtacgcgaaactccttggc
ggcggcgcggaggtggtcgcgttcgcgcgcagcgacgagaagctcaagatcgccaaggac
aacggcgccgaccatgtcgtcaacgtgcgggacaaggacaccgaagacgtccgcgccgaa
ctcgaatcggccactgggcgaacagaactcgatgcggtcatcgagtgcgccggatcggag
gactcgatccggctggcgttctcgctgctggcagccgagggcgcggtggcgtccgtcggc
ctcatcggcaaccgcgtcgacatcccgctcttcccgttggtggcgcgggagtacaccttt
tacgggtcgttctggggcaactacaacgacctcaccgaggtgctggcgctggcgcggacg
ggacagctcaagcactcggtcacccgggtgcgcttcgacgacgtcaacgagaccctcgag
gcgatcgcccgtggcgacgtgctcgggcgcgcagtgatcgtctacgactga

DBGET integrated database retrieval system