KEGG   Mycolicibacterium vanbaalenii: Mvan_5575Help
Entry
Mvan_5575         CDS       T00449                                 

Definition
(GenBank) Glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00860  Porphyrin and chlorophyll metabolism
mva00970  Aminoacyl-tRNA biosynthesis
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
Module
mva_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvan_5575
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mvan_5575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mva01007]
    Mvan_5575
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mva03016]
    Mvan_5575
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mva02048]
    Mvan_5575
Enzymes [BR:mva01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Mvan_5575
Amino acid related enzymes [BR:mva01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Mvan_5575
Transfer RNA biogenesis [BR:mva03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mvan_5575
 Prokaryotic Type
   Other AARSs
    Mvan_5575
Prokaryotic defense system [BR:mva02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Mvan_5575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ABM16340
UniProt: A1TGP0
Position
5954895..5955827
Genome map
AA seq 310 aa AA seqDB search
MRGGYRECTLTGKVVPVTNSPGAGRFAPSPSADLHIGNLRTAVLAWLFARSTGRRFLMRV
EDLDDRTHTDIADRQLADLAALGVTWDGPAIWQSEHPERYDAVVDTLDERGLLFECYCTR
RDIAQAPRAPHAPEGAYPGTCRNLDNADRERRRRETGRPPALRLRTDTTEYTVHDVLHGD
YTGLVDDFVVRRGDGVPAYNLAVVVDDAATGVDQVVRGDDLLSSSPRQAYLARLLGHPEP
VYAHVPLVLNGDGARLAKRDGAVTLAEIGVAQALRQIADSLGYEAHAVGGMLDEFDPRRL
PRVPWVYRPG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcggctaccgtgagtgcacgctcacgggcaaggtggtacccgtgaccaactcc
cccggcgcaggtcggttcgcgccgagcccgtcggcggacctgcacatcggcaacctccgc
accgccgtgctggcgtggctgttcgcccgctcgaccggccgccggttcctgatgcgcgtc
gaggacctcgacgaccgcacccacaccgacatcgccgaccgccagctcgccgacctggcc
gcgctcggcgtcacgtgggacgggcccgccatctggcagtccgaacaccccgagcgctac
gacgccgtcgtcgacaccctcgacgaacgcggactgctgttcgaatgctattgcaccaga
agggatatcgcccaggcaccgcgggctccccacgctcccgagggcgcctatccgggcacc
tgccggaacctggacaacgccgaccgcgaacgccgcagacgcgagaccgggcggccaccg
gcattgcgtttgcgcaccgacaccacggagtacaccgtgcacgacgtgctgcacggcgac
tacaccggcctggtcgacgacttcgtcgtgcgccgcggcgacggggtgccggcctacaac
ctggcggtggtcgtcgacgacgccgcgacgggcgtcgaccaggtggtgcgcggtgacgac
ctgttgtcgtcctcgccgcggcaggcctacctggccaggctgctcggccatcccgaaccg
gtgtacgcccacgtgccgttggtcctcaacggcgacggtgccaggctggcgaagcgcgac
ggtgcggtgacgctggccgagatcggtgtcgcgcaggcgctcaggcagatcgccgactcg
ctcgggtacgaggcgcacgcggtcgggggcatgctcgacgagttcgatccgcgacggttg
ccgcgcgtgccgtgggtataccggcccgggtga

DBGET integrated database retrieval system