KEGG   Methanosarcina vacuolata: MSVAZ_0288Help
Entry
MSVAZ_0288        CDS       T03815                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit B
  KO
K00578  tetrahydromethanopterin S-methyltransferase subunit B [EC:2.1.1.86]
Organism
mvc  Methanosarcina vacuolata
Pathway
mvc00680  Methane metabolism
mvc01100  Metabolic pathways
mvc01120  Microbial metabolism in diverse environments
mvc01200  Carbon metabolism
Module
mvc_M00357  Methanogenesis, acetate => methane
mvc_M00567  Methanogenesis, CO2 => methane
mvc_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mvc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSVAZ_0288
Enzymes [BR:mvc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSVAZ_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrB
Motif
Other DBs
NCBI-ProteinID: AKB42557
UniProt: A0A0E3Q211
Position
332287..332517
Genome map
AA seq 76 aa AA seqDB search
MEPVFERVDKLDAIAEDLLNSLSPSKPLLNSWPGRENTSYMAGFYGNTFYGVVVGLAFSG
LLALIIYISSLMKGVV
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgtgtttgagagagtggacaaactggacgcaattgcagaagacctgctgaat
tccctttcgcccagcaaaccgcttcttaattcctggccaggccgtgagaacacctcctat
atggcaggattttatggaaacactttctacggagttgttgtaggtcttgccttcagcggg
ctactggctcttatcatatatatatcaagtttgatgaaaggggtggtgtaa

DBGET integrated database retrieval system