KEGG   Methanosarcina vacuolata: MSVAZ_2221Help
Entry
MSVAZ_2221        CDS       T03815                                 

Definition
(GenBank) Coenzyme B synthesis from 2-oxoglutarate: steps 4, 7, 8, 11, and 12 (small subunit)
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
mvc  Methanosarcina vacuolata
Pathway
mvc00300  Lysine biosynthesis
mvc00680  Methane metabolism
mvc01100  Metabolic pathways
mvc01120  Microbial metabolism in diverse environments
mvc01130  Biosynthesis of antibiotics
mvc01210  2-Oxocarboxylic acid metabolism
mvc01230  Biosynthesis of amino acids
Module
mvc_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mvc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSVAZ_2221
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSVAZ_2221
Enzymes [BR:mvc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     MSVAZ_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: AKB44490
UniProt: A0A0E3Q6V1
Position
complement(2842007..2842507)
Genome map
AA seq 166 aa AA seqDB search
MSLIIGRVWKFGDNVNTDEIIPGKYLRSKDVQIFAAHAMEGIDQEFTKKFRIGDIVVAGT
NFGCGSSREQAPLALKYAGVSCVIAKSFARIFFRNAINIGLPLIEVDIECQEGDKVKVDL
AKGEVTVSDRDIFKGNKLPDFLLEILNDGGLVAHRKKQSASKNINL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttattataggccgggtctggaaattcggagacaacgttaatactgatgaaata
atcccgggcaagtatttgcggagcaaagatgtacagatctttgcagctcatgcaatggaa
ggaattgatcaggaatttacaaaaaagttcaggattggagatatcgttgttgcaggcact
aacttcggctgtgggtcttcaagagaacaggctcctcttgctttgaaatatgcaggagta
tcatgtgttatagcaaagtcttttgccagaatctttttcagaaatgcgatcaatatcggg
ctacctctcatagaggttgatattgagtgccaggaaggagataaagttaaagttgatctg
gccaaaggtgaagttacggtttcagatagagacatatttaaagggaacaaattgccggat
ttcctgcttgagatacttaatgatggtggacttgtagctcatcgaaaaaagcaaagcgcg
agcaaaaatataaacttataa

DBGET integrated database retrieval system