KEGG   Methanosarcina vacuolata: MSVAZ_2228Help
Entry
MSVAZ_2228        CDS       T03815                                 

Definition
(GenBank) Nitrogenase (vanadium-iron) delta chain
  KO
K22898  vanadium nitrogenase delta subunit [EC:1.18.6.2]
Organism
mvc  Methanosarcina vacuolata
Pathway
mvc00910  Nitrogen metabolism
mvc01100  Metabolic pathways
Module
mvc_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:mvc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MSVAZ_2228
Enzymes [BR:mvc01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.2  vanadium-dependent nitrogenase
     MSVAZ_2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AnfG_VnfG
Motif
Other DBs
NCBI-ProteinID: AKB44497
UniProt: A0A0E3Q6V5
Position
complement(2849544..2849882)
Genome map
AA seq 112 aa AA seqDB search
MNEKIGEVTALIQEQCLWQFFSRSWDREENIEGIMTMTGKILNGDKINLVTPADKAFYSD
AKILAADLQKKIPWISELDKSGVLELIEGVKKRLLYITVKKSRNCELNLSNY
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaaataggggaagttacggctcttatccaggaacagtgtttatggcagttt
ttttcaagaagctgggacagagaggaaaacattgaaggtattatgacaatgaccggtaaa
attctgaacggagataaaataaatcttgtaactccggcagataaagcgttttattccgat
gcaaaaatccttgctgctgatcttcagaaaaagatcccctggatctccgaacttgacaaa
tcaggagtactggaattaattgaaggcgtcaaaaaaagattgctctatattactgtaaaa
aagtcacgtaactgcgaactgaacttgtcaaattactaa

DBGET integrated database retrieval system