KEGG   Microterricola viridarii: AWU67_01040Help
Entry
AWU67_01040       CDS       T04252                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mvd  Microterricola viridarii
Pathway
mvd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AWU67_01040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mvd03011]
    AWU67_01040
Ribosome [BR:mvd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AWU67_01040
  Bacteria
    AWU67_01040
  Archaea
    AWU67_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMB57678
UniProt: A0A109QX59
Position
236795..237160
Genome map
AA seq 121 aa AA seqDB search
MVESIARVRHIRVTPQKARRVVNLIRGKQAQEALAILKFAPQGASEPVYKLVASAIANAR
VKADASNTFLDEQDLFISQAFVDEGATLKRFQPRAQGRAFQILKRTSHITVVLTTPEEGT
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgcgtgcgacacatccgcgtcaccccccagaaggctcgtcgc
gttgtcaacctgatccgcggcaagcaggcacaggaagctttggcaatcctgaagttcgca
cctcagggtgcgagcgagcccgtgtacaagctggttgcctcggcaatcgccaacgcgcga
gtcaaggcagacgcctcgaacaccttcctggatgagcaggatctgttcatctcgcaggca
ttcgttgatgagggtgcaaccctcaagcgtttccagccgcgtgcacagggccgcgcattc
cagattctgaagcgcaccagccacatcactgttgtgctcaccactcctgaggagggcacg
aagtaa

DBGET integrated database retrieval system