KEGG   Microterricola viridarii: AWU67_07730Help
Entry
AWU67_07730       CDS       T04252                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mvd  Microterricola viridarii
Pathway
mvd00480  Glutathione metabolism
mvd00590  Arachidonic acid metabolism
mvd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AWU67_07730
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWU67_07730
Enzymes [BR:mvd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AWU67_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AMB58771
UniProt: A0A0X8E1R3
Position
complement(1666178..1666705)
Genome map
AA seq 175 aa AA seqDB search
MNIREIPVTTLDGRSTTLAEFGDGALLVVNVASKCGFTPQYTQLEALHEKYGEQGLTIVG
FPCNQFAGQEPGNADKIQDFCSINYGVTFPLMEKVKVNGRHAHPLYNELHDVPDTGGKTG
RVRWNFEKFVIGADGAITRFRSAVTPDDPAVIAAIEAGLPARTVDAEPAEAPPAS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattcgtgagatccccgtgaccacccttgacggtcgcagcacaacgcttgccgag
ttcggcgacggtgccctgctcgtcgtgaacgtggcgtccaagtgtggctttactccgcag
tacacccagctggaggccctgcacgagaagtatggcgagcaggggctgaccatcgtcggc
ttcccctgcaaccagttcgccgggcaggagccgggcaatgccgacaagatccaggatttc
tgctcgatcaactacggcgtgacgttccccctcatggagaaggtcaaggtcaacggtcgt
cacgcgcatccgctctacaacgagctgcacgatgtgccggacaccggtggcaagacgggt
cgcgtgcgctggaacttcgagaagtttgtgatcggcgccgacggcgcgatcacgcgcttc
cggtcggcggtcacgcccgacgacccggccgtgattgccgcgatcgaggcgggcctgccc
gcccgcaccgtcgacgcggaaccggcagaggctccgcccgcgtcctga

DBGET integrated database retrieval system