KEGG   Mannheimia varigena USDA-ARS-USMARC-1388: X875_10940Help
Entry
X875_10940        CDS       T03029                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
mve  Mannheimia varigena USDA-ARS-USMARC-1388
Brite
KEGG Orthology (KO) [BR:mve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mve03009]
    X875_10940
Enzymes [BR:mve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     X875_10940
Ribosome biogenesis [BR:mve03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    X875_10940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AHG79712
Position
1153302..1154402
Genome map
AA seq 366 aa AA seqDB search
MFNKLALYCRAGFEKEVAGEINDKAAQLGIFGFANLKENSGYVIFECYQAGEADKLAQEL
KFEQLIFVRQMVVVGDLIQNLPENDRIPPILEQYAELNPRNSSDIFVETPDTNEAKELLT
FCRKFTVPLRSALKKQGWLGKSETAKGSVSLHILFVRSGACYVGYAYNHNKSPFFMGIPR
LKFPAEAPSRSTLKLEEAILTFIPQAEEKKRFNDTMTGVDLGACPGGWTYQLVKRGVFVY
AVDHGKMAASLHDTGRIEHCPEDGFKFQPPKRKKVDWLVCDMVEQPIRIAKLIAKWLING
WCRETIFNLKLPMKKRYQEVQLCLNFLEEELAKHGFWFKIQAKHLYHDREEITVHIAVMG
KSEKHH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttcaataaattagccttatattgtcgtgccggttttgaaaaagaggtggcaggcgaa
atcaacgataaagcagctcaacttgggattttcggttttgccaacctcaaagaaaacagc
ggttatgtgatttttgaatgctaccaagcaggggaggcggataaattagcccaagagtta
aaatttgagcagttgatctttgttcgccaaatggttgtagtaggcgatttgatacaaaac
ttacccgaaaatgaccgaattccgccgatcttggagcaatatgccgagttaaaccctcgc
aacagttcggacatttttgtggaaacgccggatacaaacgaagccaaagaattactcacg
ttctgccgaaaatttactgttccgctgcgttctgcgttgaaaaagcaaggttggttaggc
aaatctgaaaccgcaaagggcagtgtgagcttgcatattctgtttgttcgctcaggggcg
tgctatgtgggttacgcctataatcacaacaaatcgccgttttttatgggaatccctcgt
ttaaaattcccagcagaagccccaagccgttcaaccctgaaactggaagaagcaattttg
acctttattccgcaagcagaggagaaaaaacgctttaacgacacaatgactggtgtcgat
ctcggggcttgcccgggcggttggacctatcagctcgtgaaacgaggcgtgtttgtgtat
gcggtcgatcacggcaaaatggcagcgagtttgcacgataccgggcgaattgaacattgc
cccgaagatggttttaaattccaaccacccaaacgcaagaaagtggattggctggtgtgt
gatatggtagagcagccaattcgtattgctaaattaatcgccaaatggctgattaacggt
tggtgtcgagaaacgattttcaacctaaaattgccgatgaaaaagcgttatcaagaagtg
cagttgtgcttaaatttcttagaagaagagctggcaaaacacggtttttggttcaaaatt
caagctaaacatttataccacgatagggaagaaatcaccgtacatattgcggtgatggga
aaatcagaaaaacatcattag

DBGET integrated database retrieval system