KEGG   Mannheimia varigena USDA-ARS-USMARC-1388: X875_13740Help
Entry
X875_13740        CDS       T03029                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mve  Mannheimia varigena USDA-ARS-USMARC-1388
Pathway
mve00071  Fatty acid degradation
mve00072  Synthesis and degradation of ketone bodies
mve00280  Valine, leucine and isoleucine degradation
mve00310  Lysine degradation
mve00380  Tryptophan metabolism
mve00620  Pyruvate metabolism
mve00630  Glyoxylate and dicarboxylate metabolism
mve00640  Propanoate metabolism
mve00650  Butanoate metabolism
mve00900  Terpenoid backbone biosynthesis
mve01100  Metabolic pathways
mve01110  Biosynthesis of secondary metabolites
mve01120  Microbial metabolism in diverse environments
mve01130  Biosynthesis of antibiotics
mve01200  Carbon metabolism
mve01212  Fatty acid metabolism
mve02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X875_13740
   00630 Glyoxylate and dicarboxylate metabolism
    X875_13740
   00640 Propanoate metabolism
    X875_13740
   00650 Butanoate metabolism
    X875_13740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X875_13740
   00072 Synthesis and degradation of ketone bodies
    X875_13740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X875_13740
   00310 Lysine degradation
    X875_13740
   00380 Tryptophan metabolism
    X875_13740
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X875_13740
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X875_13740
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X875_13740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mve04147]
    X875_13740
Enzymes [BR:mve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X875_13740
Exosome [BR:mve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X875_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG79992
Position
1464604..1465785
Genome map
AA seq 393 aa AA seqDB search
MKNVVIASAVRTAIGSFGGSLSGVSAVELGTTVIKSAIEKSGIDIAAVDEVIMGNVLQAG
LGQNPARQALLRAEIAQEVPAYTVNKVCGSGLKAVALATQAIKAGDANIIVAGGMENMSQ
APYLLDSKSRWGYRLGDAKVQDVILSDGLMCAENHYHMGITAENVAKKYGITREMQDELA
LASQQKATAAIQSGAFKNEIVPLNIKIKRKDVVFDTDEFVKQDSTLDALAGLRTAFDKEG
TVTAGNASGINDGAAALVIVEEETAKSLGLNILARIRGYASGGVAPDIMGMGPVPATLNA
LKKAGLQLNDIDLIEANEAFAAQFLAVGKELNFAPEKVNVNGGAIALGHPIGASGARILV
TLLHAMHTRDKQFGLATLCIGGGQGIALIVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtcgttattgcaagtgcggtacgtaccgcaatcggtagttttggcggttct
ttatccggtgtatcagcggttgagcttggtacaactgtaattaagtcagcgattgaaaaa
tcaggcatagatattgctgccgtcgatgaagtgattatgggtaatgttttgcaagcaggt
cttggacaaaaccctgctcgccaagcgttattacgtgcggaaattgctcaagaagttcca
gcttatactgtcaataaggtatgtggctcaggcttaaaagcagtggcgttagctacacag
gcaattaaagcgggtgatgccaatatcattgtcgcaggtggtatggaaaatatgagccag
gctccatacttattagattctaaatctcgctggggatatcgtttaggtgatgcgaaagtt
caagatgtgatcttatctgatggcttaatgtgtgcagaaaatcactaccatatgggtatt
acagccgaaaatgtagcgaaaaaatatggtatcacccgtgaaatgcaagatgaattagca
cttgcttctcagcaaaaagcgacagcggcaattcaatccggtgcatttaaaaatgagatc
gtgccattaaacatcaaaatcaaacgtaaagatgttgtttttgatactgatgagtttgta
aaacaagattctactcttgatgcgttagcaggtcttcgcactgcttttgataaagaaggg
acagtgactgcaggtaatgcatcaggtattaacgatggtgcggcagcattagttatcgta
gaggaagaaactgcaaaatcattaggtttaaatattcttgctcgtataagaggctacgca
agtggtggagttgctccggatattatgggtatgggaccagttccagcaactttaaatgca
ttgaaaaaagcaggcttacaattaaacgatattgatttaattgaagcaaacgaagcattt
gcagcacaattcttagcagtgggcaaagaattaaactttgctcctgaaaaagtaaacgta
aacggtggtgcgattgcacttggtcacccaataggtgcaagtggcgctcgtattttagtt
accttgttacatgcaatgcatactcgtgataaacaatttggtttagcaacattatgtatt
ggtggtggtcaaggtatcgcattgatcgttgaacgtgtttaa

DBGET integrated database retrieval system