KEGG   Mannheimia varigena USDA-ARS-USMARC-1312: X874_11310Help
Entry
X874_11310        CDS       T03028                                 

Definition
(GenBank) Siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
mvg  Mannheimia varigena USDA-ARS-USMARC-1312
Pathway
mvg00860  Porphyrin and chlorophyll metabolism
mvg01100  Metabolic pathways
mvg01110  Biosynthesis of secondary metabolites
mvg01120  Microbial metabolism in diverse environments
Module
mvg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mvg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    X874_11310
Enzymes [BR:mvg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     X874_11310
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     X874_11310
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     X874_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Shikimate_DH Radical_SAM AlaDh_PNT_C Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AHG77767
Position
1218013..1219449
Genome map
AA seq 478 aa AA seqDB search
MSYLPIFVDLKKRPVLVVGGGHVATRKITTLLKVGANVKIVARELDSPLHNLLEEGKVEW
FATEFEPEQVNQAYLIIAATDDNELNNFVFKSAEAAQRLVNVVDDQPHCSYIFPSVIDRS
PIQIAISSGGAAPVLIRLLREKLEALIPQNVGEMASISGRWRNAVKAKFPHMTQRRRFWE
KLFTNLHFQRLTETHQTAQAEALLEQELEADNPIIGEVSLVGAGPGDAGLLTLKGLQAIQ
QADVVLYDALVSESVLELVRRDADRVFVGKRAGKDCVKQEETNALLVKYAKKGKRVVRLK
GGDPFVFGRGGEELEVLKAENIPFNVVPGITAALGATAYAGIPLTHRDYSQNATFITGHI
KPDGTSLKWEALAQSNQTLVVYMGTIKAGELASQLQRYGKPADTPVAIVSNGTLPNQSTQ
IGTLSELPELSANAPTPALIVIGEVVKLQPQLAWFGSQAQQFISTQETLWNNQLEKCA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttacctatttttgtcgatttaaaaaaacgccctgttttagttgtaggtggc
ggacacgttgccacacgcaaaattactacgttattaaaagtgggggctaacgtgaaaatt
gtggctcgtgaattagatagcccgttgcataacctacttgaggaaggaaaagtggaatgg
ttcgcaacagaattcgagccagagcaggttaatcaagcctatctcattattgctgccacc
gatgataatgaacttaacaactttgtatttaaaagtgccgaagccgcacagcgtttggtt
aatgtagtggatgaccaaccgcattgcagctatatattcccttctgtgatcgaccgttcg
ccgattcaaattgcaatttcaagcggtggtgcagcccctgtgttaattcgtctattgcgt
gaaaaattagaagccttaattccacaaaatgtgggcgaaatggcaagtatttcaggcaga
tggcgaaatgcagtaaaagcaaaattcccgcatatgactcaacgcagacgcttttgggaa
aagctgttcactaatttgcattttcaacgtttaaccgaaacccaccaaacagctcaagca
gaagcattattagaacaagaattagaagctgacaacccaattattggcgaagtttcattg
gtaggagcaggtccaggcgatgctggcttgctaacacttaaaggcttacaagccattcag
caagctgatgtcgtgctttatgatgcgttagtgtctgaaagcgtattagagttggttcgc
cgtgatgctgaccgagtatttgttggcaaacgagcaggtaaagactgtgtaaaacaagaa
gaaaccaatgctcttttagtgaaatatgcgaaaaaaggaaagcgtgttgttcgcttaaaa
gggggcgatccttttgtgtttggacgtggcggcgaagaactggaagttttaaaagcggag
aatattccatttaatgttgtacctggtattacagccgcattaggtgcgacggcatacgct
ggtattccgcttactcatcgtgattattcacaaaatgcaacctttattacagggcatatc
aagccagatggcacaagcttaaaatgggaagcccttgctcaaagtaatcaaacattagtg
gtttatatgggtacaattaaagctggagagcttgcaagccaattacagagatatggcaaa
cctgccgacacgccagtcgctattgtcagtaacggtacattaccaaatcaaagcacacaa
atcggcacgttaagtgaattgccagaactttctgcgaatgcaccaacgcctgcactcatt
gtgattggcgaggtagtaaaattacaaccgcaacttgcgtggttcggctcacaagcccag
caatttatttcaacccaagaaacattatggaataatcaattagaaaaatgtgcctaa

DBGET integrated database retrieval system