KEGG   Mannheimia varigena USDA-ARS-USMARC-1312: X874_3770Help
Entry
X874_3770         CDS       T03028                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mvg  Mannheimia varigena USDA-ARS-USMARC-1312
Pathway
mvg00620  Pyruvate metabolism
mvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X874_3770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mvg02000]
    X874_3770
Enzymes [BR:mvg01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     X874_3770
Transporters [BR:mvg02000]
 Other transporters
  Primary active transporters [TC:3]
   X874_3770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3 GCV_H Amidohydro_1 NQRA Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AHG77015
Position
complement(403221..405023)
Genome map
AA seq 600 aa AA seqDB search
MTTQQKKIAITDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYWSLEAWGGATFDSCIR
FLGEDPWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVDKFVERSVANGMSVFRVF
DALNDPRNMQAALQAVKKHGGHAQGTLSYTTSPVHTLQTWLDVTEQLLEIGVDSLVIKDM
SGILTPMAAHELVSEIKKRYDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTSISSMSGT
YGHPATESIVATLQGTPYDTGLQIPELEKIAAYFRDVRKKYAKFEGQLRGIDSRILVAQV
PGGMLTNLESQLKQQNASDKLDLVLQEIPRVREDLGNIPLVTPTSQIVGTQAVMNVLMGE
RYKTIAKETAGILKGEYGRTPAPVNKALQDRVLEGAAPMTDRPADHIPPEVEKLIAEVTA
QAKEKGITLSENTIDDVLIVALFQQIGWKYLENRNNPSAFEPVPNADDVKPAAAAPKAQP
QAGAAVYTVELEGKAFVVKVSEGGNITNIAQTTAAAPAQQAVNSTQKSANAEPVNAPMAG
NILKVEVKEGQQVAEGDVLLILEAMKMETQICAAKSGTVQGINVKQGDVVAVNQTLMSIA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaacagaaaaaaattgcgatcaccgatgtagttttgcgtgatgctcatcaa
tctctctttgcgacccgcttacgtttggatgatatgctgccgattgccgccgagctcgac
aaaatcggctattggtctttggaagcatggggcggtgcgacctttgacagctgtattcgc
tttttaggggaagatccgtgggtgcgtttgcgtgagctgaaaaaagcaatgccgaaaacc
ccactgcaaatgttactgcgtgggcaaaatctgttgggttatcgtcactatgccgatgat
gtggtggataaattcgtagaacgttccgttgccaacggaatgagcgttttccgtgtgttt
gatgccttgaacgaccctcgcaatatgcaggcagcgttacaagcggtcaaaaaacacggc
gggcacgcacaaggcacattgagctacaccacaagcccggttcatacgctgcaaacgtgg
ttagatgtgaccgagcagttattagaaatcggcgtggattctttggttatcaaagatatg
tcggggattttgacgcctatggcagctcacgagttggtgagcgaaatcaaaaaacgctac
gatgtagaacttcatttgcattgccactccaccaccggtatggcagaaatggcgttactt
aaagcgattgaagccggtgtggatggtgtggacacctccatttcttcaatgtccggtact
tatggtcaccctgctaccgaatccatcgtggcaaccttgcagggcacgccgtatgacacg
ggcttgcaaattcctgaattagaaaaaattgcggcttacttccgtgatgtgcgtaaaaaa
tatgcgaaatttgagggacaattacgaggtatcgacagccgaattttagtggctcaagtg
ccaggcggaatgctcactaaccttgaaagccagctcaaacagcaaaatgcctccgacaaa
ttagatttagtgttgcaagaaattccacgagtgcgtgaagatttgggcaacattccgctc
gttacgccaacctcgcaaattgtcggtacacaagcggtaatgaacgtgttaatgggcgag
cgttacaaaaccatcgctaaagaaactgctggcatcttaaaaggagaatatggccgtaca
ccagctccggtgaataaagcgttgcaagatcgtgtgctggaaggggctgctccgatgacc
gaccgccctgcggatcatattccaccggaagtggagaaattgatcgcagaagtgaccgct
caagcaaaagaaaaaggtattacgctttctgaaaatacgattgatgatgtattaatcgtg
gcactattccaacaaatcggttggaaatatttggaaaaccgcaacaatccgtctgccttt
gagccggtgccgaatgccgatgatgtgaaaccggctgcagctgctccgaaagctcagccg
caagcaggtgctgcggtttacaccgttgaacttgagggcaaagcctttgtggtgaaagtg
agcgaagggggaaatattaccaatatcgctcaaactaccgctgctgcccctgctcaacaa
gcggtcaattccactcaaaaatctgcaaatgccgaaccggtgaatgcaccgatggcaggc
aatattttgaaagtggaagtgaaagaggggcagcaagttgccgagggcgatgtgttgctg
atccttgaagcgatgaaaatggaaacccaaatttgtgcggccaaatccggcacggtgcaa
ggcattaatgtgaaacagggcgatgtggttgccgttaatcaaaccttgatgagcattgcg
tag

DBGET integrated database retrieval system