KEGG   Mannheimia varigena USDA-ARS-USMARC-1312: X874_7080Help
Entry
X874_7080         CDS       T03028                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mvg  Mannheimia varigena USDA-ARS-USMARC-1312
Pathway
mvg00071  Fatty acid degradation
mvg00072  Synthesis and degradation of ketone bodies
mvg00280  Valine, leucine and isoleucine degradation
mvg00310  Lysine degradation
mvg00380  Tryptophan metabolism
mvg00620  Pyruvate metabolism
mvg00630  Glyoxylate and dicarboxylate metabolism
mvg00640  Propanoate metabolism
mvg00650  Butanoate metabolism
mvg00900  Terpenoid backbone biosynthesis
mvg01100  Metabolic pathways
mvg01110  Biosynthesis of secondary metabolites
mvg01120  Microbial metabolism in diverse environments
mvg01130  Biosynthesis of antibiotics
mvg01200  Carbon metabolism
mvg01212  Fatty acid metabolism
mvg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X874_7080
   00630 Glyoxylate and dicarboxylate metabolism
    X874_7080
   00640 Propanoate metabolism
    X874_7080
   00650 Butanoate metabolism
    X874_7080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X874_7080
   00072 Synthesis and degradation of ketone bodies
    X874_7080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X874_7080
   00310 Lysine degradation
    X874_7080
   00380 Tryptophan metabolism
    X874_7080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X874_7080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X874_7080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X874_7080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mvg04147]
    X874_7080
Enzymes [BR:mvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X874_7080
Exosome [BR:mvg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X874_7080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG77344
Position
complement(745108..746289)
Genome map
AA seq 393 aa AA seqDB search
MKNVVIASAVRTAIGSFGGSLSGVSAVELGTTVIKSAIEKSGIDIAAVDEVIMGNVLQAG
LGQNPARQALLRAEIAQEVPAYTVNKVCGSGLKAVALATQAIKAGDANIIVAGGMENMSQ
APYLLDSKSRWGYRLGDAKVQDVILSDGLMCAENHYHMGITAENVAKKYGITREMQDELA
LASQQKATAAIQSGAFKNEIVPLNIKIKRKDVVFDTDEFVKQDSTLDALAGLRTAFDKEG
TVTAGNASGINDGAAALVIVEEETAKSLGLNILARIRGYASGGVAPDIMGMGPVPATLNA
LKKAGLQLNDIDLIEANEAFAAQFLAVGKELNFAPEKVNVNGGAIALGHPIGASGARILV
TLLHAMHTRDKQFGLATLCIGGGQGIALIVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtcgttattgcaagtgcggtacgtaccgcaatcggtagttttggcggttct
ttatccggtgtatcagcggttgaacttggtacaactgtaattaagtcagcgattgaaaaa
tcaggcatagatattgctgccgtcgatgaagtgattatgggtaatgttttgcaagcaggt
cttggacaaaaccctgctcgtcaagcgttattacgtgcggaaattgctcaagaagttcca
gcttatactgtcaataaggtatgtggctcaggcttaaaagcagtggcgttagctacacag
gcaattaaagcgggtgatgccaatatcattgtcgcaggtggtatggaaaatatgagccag
gctccatacttattagattctaaatctcgctggggatatcgtttaggtgatgcgaaagtt
caagatgtgatcttatctgatggcttaatgtgtgcagaaaatcactaccatatgggtatt
acagccgaaaatgtagcgaaaaaatatggtatcacccgtgaaatgcaagatgaattagca
cttgcttctcagcaaaaagcgacagcggcaattcaatccggtgcatttaaaaatgagatc
gtgccattaaacatcaaaatcaaacgtaaagatgttgtttttgatactgatgagtttgta
aaacaagattctactcttgatgcgttagcaggtcttcgcactgcttttgataaagaaggg
acagtgactgcaggtaatgcatcaggtattaacgatggtgcggcagcattagttatcgta
gaggaagaaactgcaaaatcattaggtttaaatattcttgcccgtataagaggctacgca
agtggtggagttgctccggatattatgggtatgggaccagttccagcaactttaaatgca
ttgaaaaaagcaggcttacaattaaacgatattgatttaattgaagcaaacgaagcattt
gcagcacaattcttagcagtgggcaaagaattaaactttgctcctgaaaaagtaaacgta
aacggtggtgcgattgcacttggtcacccaataggtgcaagtggcgctcgtattttagtt
accttgttacatgcaatgcatactcgtgataaacaatttggtttagcaacattatgtatt
ggtggtggtcaaggtatcgcattgatcgttgaacgtgtttaa

DBGET integrated database retrieval system