KEGG   Mannheimia varigena USDA-ARS-USMARC-1312: X874_9820Help
Entry
X874_9820         CDS       T03028                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
mvg  Mannheimia varigena USDA-ARS-USMARC-1312
Brite
KEGG Orthology (KO) [BR:mvg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mvg03009]
    X874_9820
Enzymes [BR:mvg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     X874_9820
Ribosome biogenesis [BR:mvg03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    X874_9820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AHG77618
Position
complement(1054681..1055781)
Genome map
AA seq 366 aa AA seqDB search
MFNKLALYCRAGFEKEVAGEISDKAAQLGIFGFANLKENSGYVIFECYQAGEADKLAQEL
KFEQLIFVRQMVVVGDLLQNLPENDRISPILARYAELNPRNSSDIFVETPDTNEAKELLT
FCRKFTVPLRSALKKQGWLGKSETAKGSVSLHILFVRSGACYVGYAYNHNKSPFFMGIPR
LKFPAEAPSRSTLKLEEAILTFIPQAEEKKRFNDTMTGVDLGACPGGWTYQLVKRGVFVY
AVDHGKMAASLHDTGRIEHCPEDGFKFQPPKRRQVDWLVCDMVEQPIRIAKLIAKWLING
WCRETIFNLKLPMKKRYQEVQLCLNFLEEELAKHGFWFKIQAKHLYHDREEITVHIAVMG
KSEKHH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttcaataaattagccttatattgccgtgccggttttgaaaaagaggtggctggcgaa
atcagcgataaagccgctcaacttggaatttttggttttgctaacctcaaagaaaacagc
ggttatgtgatttttgaatgctaccaagcaggggaggcggataaattagcccaagagtta
aaatttgagcagttgatctttgttcgccaaatggttgtagtaggcgatttgctacaaaat
ttacccgaaaatgaccgaatttcgccgatattagcacgatatgccgagttaaaccctcgc
aacagttcagacatttttgtggaaacaccagatacaaatgaagccaaagaattactcacg
ttctgccgaaaatttactgttccgctgcgttctgcgttgaaaaagcaaggttggctaggt
aaatctgaaaccgcaaagggcagtgtgagcttgcatattctgtttgttcgctcaggggcg
tgctatgtgggttacgcctataatcacaacaaatcgccgttttttatgggaatccctcgt
ttaaaattcccagcagaagccccaagccgttcaaccctgaaactggaagaagcaattttg
acctttattccgcaagcagaggaaaaaaaacgctttaacgacacaatgaccggtgtcgat
ctcggggcttgcccgggcgggtggacttatcagctcgttaaacgtggcgtatttgtgtat
gcggtcgatcacggcaaaatggcagcgagtttgcacgataccgggcgaattgaacattgc
cccgaagatggttttaaattccaaccacccaaacgcaggcaagtggattggctggtgtgt
gatatggtagagcagccaattcgtattgctaaattaatcgccaaatggctgattaacggc
tggtgtcgagaaacgattttcaacctaaaactgccgatgaaaaagcgttatcaagaagtg
cagttatgcttaaacttcttggaggaagagctggcaaaacacggtttttggttcaaaatt
caagccaaacatttataccacgatagggaagagatcaccgtgcatattgcagtgatggga
aaatcagaaaaacatcattag

DBGET integrated database retrieval system