KEGG   Methanococcus vannielii: Mevan_0537Help
Entry
Mevan_0537        CDS       T00554                                 

Definition
(GenBank) DNA repair and recombination protein RadA
  KO
K04483  DNA repair protein RadA
Organism
mvn  Methanococcus vannielii
Brite
KEGG Orthology (KO) [BR:mvn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mvn03400]
    Mevan_0537
DNA repair and recombination proteins [BR:mvn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Archaeal homologous recombinant proteins
     Mevan_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad51 HHH_5 RecA AAA_25 ATPase HHH HHH_3 DNA_pol_lambd_f IMS_HHH Cdd1 HHH_2 DnaB_C HHH_8 CobU PAXNEB AAA_33
Motif
Other DBs
NCBI-ProteinID: ABR54444
UniProt: A6UPM2
Position
592180..593148
Genome map
AA seq 322 aa AA seqDB search
MADVLTELPGVGPSTAEKLIEAGYLDFMKIATSTIGELTDIEGISEKAAAKMIMAAREMC
DLGFKSGVELLNQRKSVWRLSTGSKELDEVLAGGLESQSVTEFAGMYGSGKTQIMHQSCV
NLQIASKIFAETENVLEKELPNPKSVYIDTEGTFRPERILQMAEGAGVDGQYVLDNTFVA
RAYNSDMQMLFAEKIEDLIKGGNNIKLVIIDSLTSAFRNEFTGRGKLAERQQKLGRHMAT
LNKLADLHNCVVLVTNQVAAKPDAFFGVAEQAIGGHVVGHAATFRFFLRKSKGDKRVAKL
YDSPHLPDSEAVFRITEKGIQD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttttaacagaattaccgggagtaggcccatctactgcagaaaagctaatt
gaagcaggttatttagattttatgaaaattgcaacatctacaattggcgaattaactgat
attgaaggaattagtgagaaagctgctgctaaaatgattatggcagcgagagaaatgtgt
gaccttggatttaaaagtggagtagagttattaaaccagagaaagagtgtatggaggctt
tcaactggaagtaaggaattagacgaagttttagcaggcggtcttgaaagtcagtcagtc
actgaatttgcaggaatgtatggtagtggtaaaacacaaataatgcatcaatcttgtgta
aatttacagattgcttcaaaaatatttgctgaaacagaaaatgttttagaaaaagaactc
ccaaatccaaaatcagtttatatagatactgaaggtacatttagacctgaaagaatttta
cagatggctgaaggtgcgggagttgatggacagtatgttttagataatacttttgttgca
agagcatataattccgacatgcagatgctatttgcagaaaaaatagaagatttgataaaa
ggcggaaacaatattaaattagtaattattgattctttaaccagtgcatttagaaacgag
tttactggaagggggaaactcgctgaaagacaacaaaaattaggtagacatatggcaacc
ctaaataaacttgcagaccttcacaactgtgttgttttggtaacaaaccaagttgctgca
aaacccgatgcattctttggcgttgcagagcaagctattggggggcacgttgttgggcat
gctgcaacatttagatttttcttgagaaaatcaaaaggagataaaagagttgcgaaactt
tacgattccccacatttgcccgattcagaagcagtatttagaattactgaaaaaggcatt
caggactaa

DBGET integrated database retrieval system