KEGG   Methanococcus vannielii: Mevan_0889Help
Entry
Mevan_0889        CDS       T00554                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
mvn  Methanococcus vannielii
Brite
Enzymes [BR:mvn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mevan_0889
Transfer RNA biogenesis [BR:mvn03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mevan_0889
Chromosome and associated proteins [BR:mvn03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Mevan_0889
   HAT complexes
    Elongator complex
     Mevan_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 DUF2717
Motif
Other DBs
NCBI-ProteinID: ABR54794
UniProt: A6UQM2
Position
complement(909145..910770)
Genome map
AA seq 541 aa AA seqDB search
MSEYSKFIRCIIINLLAEKEKIRGLDPKRKKQKVEDIKAKCLRKHGLNTGFPPNSDVIAH
ATEEEKTEIVPILRKKPIRTLSGVSVVAVMTSPEPCPHGKCSFCPGGKESNFGNVPQSYT
GKEPATMRGIMYDFNPYIQTVERLKQLEKVGHPTDKVELIIMGGTFPARDVGYQESFIKG
CLDAMNGEISNSLNEAKLKNESAKHRCVALTIETRPDYCGEKEINQMLNLGATRVELGIQ
STYGEVLDFVKRGHDIDASINATRLLKDSGLKVSYHIIPGLPNTTFEMDKKMIETIFEDN
RYKPDLIKFYPCLVIPGTEIYDLWKQGKFSPMNDEKAIELIVYGKSIMPKWIRTSRIQRD
IPATVINEGVRKSNLGELVYNRLEELGIKCKCIRCREVGHVGYKKGIFPEIENIKLYRTD
YDANFGKEVFLSFEDLKNDLLIGYLRLRIPSKPFRPEITDNTSIIRQVHVCGQQKELDAS
SIESSWQHKGYGRLLIEEAEKISKEEFGKNQILINSGIGVIEYYKKLGYKKVGPYMGKIL
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaatattctaaatttatacgatgcattatcataaatttactcgctgaaaaggaa
aaaatacgtggacttgatccaaaacggaaaaaacagaaagttgaggacatcaaagcaaaa
tgtttaagaaaacatggtctaaatactggttttcccccaaattctgacgtgatagcccac
gcaaccgaagaagaaaaaacagaaatagttccaatacttagaaaaaagcctatacgaact
ctttctggtgtttcagtagttgcagtcatgacctcccctgaaccgtgtccccatggaaaa
tgttcattctgccccggtggaaaagaaagtaattttggaaatgtcccccaaagttatact
ggaaaagagcctgcaacaatgcggggaattatgtatgactttaatccgtatatacagacc
gttgaacgattaaaacagcttgaaaaagttggacaccctacagacaaggtagaattgatt
ataatggggggaacgtttcctgcaagggatgtaggatatcaagaaagctttataaaagga
tgtctcgatgcaatgaatggggaaatttcaaacagcctaaacgaagcaaaattaaaaaat
gaaagtgcaaaacacagatgtgttgcattaacaattgaaacaaggccagattactgtggg
gaaaaagaaataaaccaaatgcttaatttaggagccacacgtgttgaacttggaattcaa
agtacttatggcgaagttttggactttgtaaaacgtgggcatgatatagatgcttcaatc
aatgctacaaggcttttaaaagatagcggccttaaagtttcataccatattattccaggg
ctaccaaatacgacttttgaaatggataaaaaaatgattgaaactatctttgaagataat
agatataagccagatttaattaaattttacccgtgtttagtaattcctggaacagaaatt
tatgatttgtggaaacagggaaaatttagtcccatgaatgatgaaaaagcaatagaattg
atagtttatggaaaatcaataatgccaaaatggataagaacttcaagaattcaaagagac
attcctgcaacagttataaacgaaggggtaaggaaaagtaatttaggagaactcgtatac
aataggcttgaagagctaggcataaagtgcaaatgtatacgttgtagggaagttgggcat
gttggctataaaaagggaatatttcctgaaattgaaaatattaagttatatcggactgac
tatgatgcaaattttggaaaagaagtatttttatcatttgaagatttgaaaaatgatctt
ttaataggatacttaaggcttagaattccctcaaaaccgtttaggccggaaataacagat
aatacttcaattatacgacaggttcatgtatgcggtcaacaaaaagaacttgatgcaagt
tcaattgaatcttcatggcaacacaaaggatatggccggcttttaattgaggaagctgaa
aaaatttcaaaagaagaatttggtaaaaatcaaatattgattaacagcggaataggggtt
attgagtactacaaaaaactaggatataaaaaagttggcccatacatgggaaaaattctt
aaataa

DBGET integrated database retrieval system