KEGG   Methanococcus vannielii: Mevan_1336Help
Entry
Mevan_1336        CDS       T00554                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00010  Glycolysis / Gluconeogenesis
mvn01100  Metabolic pathways
mvn01110  Biosynthesis of secondary metabolites
mvn01120  Microbial metabolism in diverse environments
mvn01130  Biosynthesis of antibiotics
mvn01200  Carbon metabolism
mvn01230  Biosynthesis of amino acids
Module
mvn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mvn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mevan_1336
Enzymes [BR:mvn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mevan_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C NAD_binding_3 Semialdhyde_dh TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABR55233
UniProt: A6URW1
Position
complement(1361879..1362901)
Genome map
AA seq 340 aa AA seqDB search
MVGVLVNGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEARMAVTKGYKLFAAIPEKKHL
FEEANIPIEGTIEDIIEDADIVVDGAPKKIGKANVENVYKKHNVKAIIQGGEKAKDAEDS
FNSLWSYNRCYGKDYIRLVSCNTTGLCRTLYAIDSITDILKARVVLVRRAADPNDIKTGP
INAIIPDPVTVPSHHGPDVVSVIPKLDGKIMTSAIIVPTTLMHMHSLMVETTGVTKDAVL
DAIEKTPRIIKVKASEGIDSTAKIIEYSRDLGRLRYDLNEIAIWEESINVVDNEIYLMQA
IHQESDVIPENIDCIRAMLEMEEDNIKSIEKTNRALGLLK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggttggagtattagtaaatggttatggctctatcggaaaaagagttgctgatgcagta
gctaaacaggatgatatgaaagtaatcggagttacaaaaacaaaacctgattttgaagct
aggatggccgttacaaaaggttacaaattatttgctgcaatacctgaaaaaaagcacctt
tttgaagaagccaatattcccattgaaggaactattgaagatattattgaagatgcagat
atcgtagttgatggagctccaaaaaaaattggaaaggctaacgtggaaaacgtgtataaa
aaacataatgttaaagcaattatccaaggtggggaaaaagcaaaagatgcagaggactca
tttaattccctttggagttacaatagatgttatggaaaagattacataagactagtatct
tgtaacactactggactatgtaggacactttatgcaattgattctataactgatatttta
aaagccagagtagttttagtaagaagggctgctgaccccaatgatataaaaacagggccc
ataaatgctattattcctgacccagtaacagttccatcccatcacgggccagatgtcgtt
tcagtaataccaaaattagatggaaaaataatgacttctgcaataattgttccaactacc
cttatgcacatgcactctttaatggttgaaactacaggagttacaaaagatgcggtttta
gatgcaattgaaaaaacgccaagaatcataaaagtaaaagctagtgaaggaattgattca
acagcaaaaataatcgaatattcaagagaccttggaagattaaggtacgacttaaatgaa
attgcaatttgggaagaaagcattaatgtagtagataatgaaatttatttaatgcaagca
attcaccaagaaagtgatgttattcctgaaaacattgattgtattagggcaatgctcgaa
atggaagaagataacataaaatccattgaaaaaacgaacagagctcttggtcttttaaaa
taa

DBGET integrated database retrieval system