KEGG   Methanococcus voltae: Mvol_0878Help
Entry
Mvol_0878         CDS       T01251                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00204  4Fe-4S ferredoxin
Organism
mvo  Methanococcus voltae
Pathway
mvo00680  Methane metabolism
mvo01100  Metabolic pathways
mvo01120  Microbial metabolism in diverse environments
mvo01200  Carbon metabolism
Module
mvo_M00567  Methanogenesis, CO2 => methane
mvo_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mvol_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_10 Fer4_9 Fer4_6 Fer4 Fer4_16 Fer4_2 Fer4_7 Fer4_21 Fer4_22 Fer4_17 Fer4_15 Fer4_8 Fer4_4 HTH_5 HTH_3 HTH_23
Motif
Other DBs
NCBI-ProteinID: ADI36537
UniProt: D7DTS7
Position
complement(995126..995617)
Genome map
AA seq 163 aa AA seqDB search
MPEHILSGIKSIVALNLRKDGKLQREIADYLEMDRSIVSHYLHGRYPSRKVIEVSEKIVK
LPMELSIPIISSLSDNKQLTKKLINSLYDIAIIYKSNACIGCGKCLECPYGAVNNTDNIG
ISIDHQACVLCGDCIDECPVSAIRFKSTGKLKFELISQDFDQP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacatatattgtcagggattaaatcgatagtagcactaaatttaaggaaagac
ggtaaattacaacgtgaaattgccgactatcttgaaatggaccgctcaatcgtttcccat
tatttgcacggtaggtatccctccagaaaagtaattgaagtttctgaaaagattgttaaa
ttaccaatggagttaagtatacccataataagttcattgagtgataataaacaacttact
aagaaattaataaattctttgtatgacattgcgataatctacaaatcaaatgcttgtata
ggttgtggaaagtgtttagagtgcccttatggtgctgtaaacaatactgacaacatcggt
atttctatagaccatcaagcgtgcgttttatgtggtgattgtattgatgagtgccctgtt
tcagcaatacgatttaaaagtactggaaaattaaaatttgaactgatttctcaggatttt
gaccagccataa

DBGET integrated database retrieval system