KEGG   Methanococcus voltae: Mvol_1133Help
Entry
Mvol_1133         CDS       T01251                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit A
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mvo  Methanococcus voltae
Pathway
mvo00680  Methane metabolism
mvo01100  Metabolic pathways
mvo01120  Microbial metabolism in diverse environments
mvo01200  Carbon metabolism
Module
mvo_M00567  Methanogenesis, CO2 => methane
mvo_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mvo00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mvol_1133
Enzymes [BR:mvo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mvol_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA Tudor_2
Motif
Other DBs
NCBI-ProteinID: ADI36790
UniProt: D7DUI0
Position
1278260..1278988
Genome map
AA seq 242 aa AA seqDB search
MADKKAPATGWPVANGEYVVGNPESCVAVVTLGSHGLDEAAIEAGAAISGPCHTENLGIE
KVIVNYISNPNIRFMVVTGSEVQGHITGQCFKALYENGIGDDGGIIGAKGAIPFMENVGQ
EPVARFQNQIVELIDMIDSEDKGKIQQTVKDCISKDPGAFEEDAMVIDLEGKAGGAGEEE
GSSVKITSPEMAIIESRMRIISKQIEQAAIVNKYNSGYYNGKIQGVAIGLFLSLLIYSML
LI
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaaaagcccctgcaacaggatggcctgttgctaatggtgaatatgttgta
ggtaatcctgaaagctgtgtagctgttgttacattgggttcacacggattagatgaagca
gctatcgaagcaggtgcagctatttcaggaccttgccacacagaaaacttgggtattgaa
aaagttatcgttaactacatttcaaatccaaacatcagatttatggttgtgacaggttca
gaagttcaaggacacattacaggacaatgtttcaaagctctctatgaaaatggaattggt
gacgatggtggtattatcggcgctaaaggagctattccgttcatggaaaacgttggacaa
gaaccagttgcaagattccaaaatcaaatcgttgaattaattgatatgattgattcagaa
gataaaggaaaaattcaacaaacagttaaagactgtatctccaaagaccctggtgcattt
gaggaagatgctatggttatagaccttgaaggtaaagcaggtggggcaggagaagaagaa
ggttcttcagttaaaataacatctcctgaaatggcaataattgaatcaagaatgagaata
atctcaaaacaaattgaacaagctgcaattgttaacaaatacaactctgggtattataac
ggtaaaatccaaggtgttgcaataggtttattcttatcacttcttatatacagtatgtta
ttaatttaa

DBGET integrated database retrieval system