KEGG   Methanococcus voltae: Mvol_1689Help
Entry
Mvol_1689         CDS       T01251                                 

Definition
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mvo  Methanococcus voltae
Pathway
mvo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mvo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mvol_1689
Enzymes [BR:mvo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Mvol_1689
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Mvol_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Trp_halogenase HI0933_like FAD_oxidored GIDA Pyr_redox_2 Lycopene_cycl FAD_binding_2 DAO Pyr_redox Thi4 NAD_binding_8 Pyr_redox_3 AlaDh_PNT_C UPF0147 SE DUF4116
Motif
Other DBs
NCBI-ProteinID: ADI37344
UniProt: D7DR67
Position
complement(1897899..1899074)
Genome map
AA seq 391 aa AA seqDB search
MRALINSYDVVVIGAGPAGSMASYNASKMGAKTLLVEKSQEIGEPVRCAEAVPKIDEIYG
IPADPSFVRTKLDGGYIVAPNGKTIAVKGGKTDGYVVERKIFDKYLAIRSAKQGTKIAVK
SRVVNIEQDGSGYLVSINHMGEEYKIKTKIVIAADGVESSMAEMVGLKSKKNVNEVCSCA
EYEMTNGKCIDDNMLELYFGSVAPKGYAWIFPKGDTVNVGLGVIGAKKSALEYLDDFISN
PVINGRLDNATPVEFKCGGAPVGGPIEKTFKEGFMIVGDAAGQISPLTGGGIALSMDCGL
IAGEVAGKCIMHNDCSEEAISEYETNWHEKYLHLLKNDLKYKNILQQLTDKELDAIGDSI
DGDLEDVDVPKIALKAVKKSPSLLKYLKELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagggcactaattaacagttatgacgttgtagttatcggcgcaggaccggcagggagt
atggcttcatataacgcttcaaagatgggggcaaaaactttattggttgaaaaatcacaa
gaaattggggaaccagttagatgtgcggaagcagttcccaaaatagatgaaatatatgga
ataccagcagacccaagttttgtacgtactaaattagatggtggatatatcgtagcacca
aacggaaaaacaatcgcagtaaaaggcggaaaaaccgacggatatgtcgttgaaagaaaa
atattcgataaatatcttgcaattcgaagtgcaaaacaaggtacaaaaattgccgtaaaa
agcagggttgtaaacattgaacaagatggaagcggatacttagtaagtattaatcacatg
ggcgaagaatataaaataaaaaccaaaatagttattgcagctgatggtgtagaaagctct
atggcggaaatggttggtttaaaatctaaaaagaatgttaatgaagtgtgctcttgtgca
gaatacgaaatgaccaacggtaaatgtatcgatgataatatgcttgaattatacttcgga
agtgttgcaccaaaaggttatgcgtggatattcccaaaaggcgatactgtaaacgtaggt
ttgggcgtaattggtgctaaaaagagtgctttagaatatttagatgattttatatctaat
cctgtgattaatggtaggttagacaatgctaccccagttgaatttaaatgtggtggtgct
ccagtaggcggacctattgaaaaaacatttaaagaaggttttatgattgtaggagatgct
gctggtcagattagtcctttaaccggtggagggatagctctttctatggattgcggttta
attgcgggagaagttgcgggaaaatgtataatgcataatgattgttctgaagaagctatt
agtgaatacgaaactaattggcatgaaaaatatttacatttgcttaaaaatgatttaaaa
tataaaaatattcttcaacaattaactgataaagaattagatgctattggtgattcaata
gatggcgatttagaagatgtagatgttcctaaaatagcattaaaagcagttaaaaagtcc
ccttcattattgaagtatttaaaagaattattataa

DBGET integrated database retrieval system