KEGG   Methanococcus voltae: Mvol_1718Help
Entry
Mvol_1718         CDS       T01251                                 

Definition
(GenBank) AMP phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
mvo  Methanococcus voltae
Brite
Enzymes [BR:mvo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mvol_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF2254 Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADI37373
UniProt: D7DR96
Position
complement(1927351..1929162)
Genome map
AA seq 603 aa AA seqDB search
MILKVKYIDLDIEKNSVVINEEDLKKSGYKVGDRLFLEVQGISLVVIIHSTNSIIKPGEV
GITKHISLKLDEGHDIELKQAIIPKSIKIIKKKLNGEILTTAEINTLISELKISRLSNTE
VSSFVAGSYINDMNMNEIVDMTKSMASTGDLLDWGRDTIVDVHSIGGIAGNKYALLVVPI
VAAAGVKIPKTSSRAITSGAGTADVLEVITNVTLTKNEIMDLIRDTNGCLIWAGGMSLAP
VDDMFINVESRLSINPKCLMLSSVMSKKVAMGIKCLVIDIPIGESAKVKTEAEARKLASS
FIELGELLKIKVECIITYGGQPLGRAIGPALEMKEALEALENPNDAPESLIEKSLSIAGI
LLEISGASMKGEGMDVAKEILYSGKALDKFREIVYKQYENKLKIISAKNKGGVNLSYDEN
YNVSENLFDNLNLNLNSEIDSEINSDENLENNESNITDGKEKDKDNKNNKDKKSKSKSKD
KGNNKKILKKDIEKIYLEKLNNLKSEDIKTGQYSYDIVSPTRGYITKVSNKGLIDVVKEA
GAPFDKKAGIMLNVKIGNNVKKGDVLYTIYSNSEEMLNNAIKLARRIYPVNVEGMIIKKV
SKF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgattctaaaagtaaaatatattgatttagacatcgaaaaaaactctgttgtaataaat
gaagaagatttaaagaaaagtggctataaagtaggagataggctatttttggaagtacaa
ggtatttctttagttgttataatacattctacaaattccatcataaaacccggagaagtt
ggaataacgaaacacatttctttaaaattagatgaagggcacgatatagaattaaaacag
gccattataccaaaatcaataaaaattattaaaaagaagcttaacggggaaattcttact
actgctgaaataaatacacttatttcagaattaaaaatcagtaggctctcaaatacggaa
gtatcctcttttgtagctggtagctatatcaatgatatgaatatgaacgaaattgtggat
atgactaaaagtatggcttcaaccggtgatttacttgattggggtagggatacaattgta
gacgttcacagtatcggaggtattgcaggtaataaatacgctttgcttgttgtccccatt
gtagccgctgccggtgtaaaaatacctaaaacttcatctcgtgccattacaagcggtgca
ggtactgcagatgttcttgaagtgattacaaacgtcacgttaactaaaaatgagataatg
gacttaattagagatactaacggttgcttaatttgggctggtggtatgagcttagcacct
gttgacgatatgtttataaatgtggaaagtaggctatcaataaaccccaaatgtttaatg
ttatcgagcgtaatgtccaaaaaggtagctatgggtattaaatgtttagtaatcgatata
cccataggagaaagtgctaaagttaaaacagaagctgaagcaaggaaattagcaagtagc
tttatagaacttggagaattgttaaaaataaaagtcgaatgtattattacttacggtggt
cagccattgggtagagcaattggtccagcgttagaaatgaaagaagcgttagaagctctt
gaaaatcctaatgatgcaccagaaagtttaatcgaaaaatcattatctattgcaggcata
cttttagaaataagcggggcttccatgaaaggggaaggtatggatgtagcaaaagaaata
ttgtattctggcaaagctcttgataaatttagagaaatagtctataaacagtatgaaaat
aaattaaaaataatatctgcaaaaaataagggaggtgtaaatttaagttatgatgaaaac
tataacgtaagtgaaaatttattcgataatttaaacttaaatttaaattctgaaattgat
tctgaaatcaattcggatgaaaatttagaaaataatgaatctaacattacagacggaaaa
gaaaaggataaagataataaaaataataaagataaaaaaagtaagtccaaaagtaaagat
aaaggtaataataaaaagatattgaaaaaagatattgaaaaaatatatttggaaaaatta
aataatttaaaatctgaagacataaaaacaggtcaatatagctacgatatagtttcacct
acacgtggatacattactaaagtatcaaacaaaggattaattgacgttgtaaaagaagct
ggcgctccttttgacaaaaaagcagggattatgttaaacgttaaaattggaaacaatgta
aaaaaaggcgacgtactgtataccatatactcaaactctgaagaaatgcttaacaatgcg
attaaattggcaagacgtatttatcccgttaatgtagaaggtatgattatcaaaaaagta
agtaaattttaa

DBGET integrated database retrieval system