KEGG   Methanococcus voltae: Mvol_1721Help
Entry
Mvol_1721         CDS       T01251                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mvo  Methanococcus voltae
Pathway
mvo00020  Citrate cycle (TCA cycle)
mvo00620  Pyruvate metabolism
mvo00720  Carbon fixation pathways in prokaryotes
mvo01100  Metabolic pathways
mvo01120  Microbial metabolism in diverse environments
mvo01200  Carbon metabolism
mvo01230  Biosynthesis of amino acids
Module
mvo_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mvol_1721
   00620 Pyruvate metabolism
    Mvol_1721
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mvol_1721
Enzymes [BR:mvo01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Mvol_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp GARS_A RimK Oxidored_nitro ATP-grasp_5 TMP-TENI ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADI37376
UniProt: D7DR99
Position
complement(1932674..1934188)
Genome map
AA seq 504 aa AA seqDB search
MFKKILIANRGEIAVRIIRACKELGIKTVAVYSEADEHSLYTALADECYSIGEAPASKSY
LNYEKILKIAEKTGADGIHPGYGFLSENSKFADECNKRNIEFIGPPIRAIELMGSKINAK
KTMKKAGVPVLPGREEPIEDEGEAAKIAKEIGYPVIIKASAGGGGIGMSVANDESELIDT
IQSTKSIAQSAFGDSTIFIEKYLEKPRHIEIQILADKHGNVIHLGDRECSIQRRHQKVIE
EAPSPIMTPELREKMGEAAKIAAKCIDYYSAGTVEFLYNGGEFYFLEMNTRVQVEHPITE
IITGVDIVKEQIKIAYGNKLPYEQKDITFKGHAIECRINAEDSVNDFIPSPGKIKHYRSP
GGPGIRIDSGVYGGAEIPPYYDSMIAKLITFGKNRDEAIVRMKRALSEYMIFGIISNIPF
HKSVLEEQDFLSGELSTHYIAEHEQVLHQKTLDYAVEIAYEEKRFIEKVFRDDKKTVAIV
GGLNAYITNLKNKDKKQYCPKEND
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaattcttattgcaaataggggagaaatagcagttagaattatccgtgct
tgtaaagaattgggtattaaaactgttgcagtttattctgaagccgatgaacattcgtta
tatactgcccttgctgacgaatgttatagtataggtgaagctccagcttccaaaagttat
ttaaattacgaaaaaatccttaaaattgctgaaaaaactggtgctgatggtatacatcca
ggatatggatttttatctgaaaactcaaaatttgcagatgaatgtaataaaagaaatatt
gaatttataggcccacctatacgagctattgaacttatgggtagcaaaattaatgctaaa
aaaaccatgaaaaaggcgggtgttcccgtattgccaggtagggaagaacctatcgaagat
gagggggaagcagctaaaattgctaaagaaattggatacccagtaatcataaaagcctct
gctggtggtggtggtattggaatgagtgtcgctaatgacgaaagcgaattaattgacaca
attcaatctacaaaatctattgctcaaagtgcttttggtgattcaacgatattcattgag
aaataccttgaaaaaccaagacacattgaaatacagattttagcagataaacacggcaat
gttatccatttaggggatagggaatgttccatacaaagaagacatcaaaaagttatcgaa
gaagccccatctccaattatgaccccagaattaagggaaaaaatgggggaagctgcaaaa
attgctgctaaatgtattgattactatagtgcaggtacagtcgaatttttgtacaatggt
ggagaattctatttcttagagatgaatacacgtgtacaagttgagcaccctatcactgaa
attattactggtgtggacattgtcaaagaacagattaaaatagcatatggaaacaaactg
ccatatgaacaaaaggacattacatttaaagggcacgctatagaatgcagaattaatgct
gaggactcagtaaacgacttcattccatctcctggtaaaattaaacattacaggtctcct
ggagggccaggtattagaatagatagtggtgtttacggaggggccgaaatacccccatat
tatgattcaatgattgccaaattaataacttttggtaaaaatagggacgaagcaatcgtt
agaatgaaaagagcactctctgaatatatgatatttggaattatctcaaatataccattc
cataaatcagttttggaagaacaggattttttaagtggggaattgtctacccactatatc
gcagaacatgaacaagtacttcatcaaaaaactttggattatgctgttgaaattgcatat
gaagaaaaaagattcattgaaaaagtgttcagggacgataaaaagactgtggctattgta
ggcggtttaaatgcatatattacaaatcttaagaataaagataaaaaacaatactgccct
aaagaaaatgattaa

DBGET integrated database retrieval system