KEGG   Mycolicibacterium vaccae: MYVA_0619Help
Entry
MYVA_0619         CDS       T04356                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYVA_0619
Enzymes [BR:mvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MYVA_0619
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MYVA_0619
    1.1.1.-  
     MYVA_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ANI37879
Position
641984..642364
Genome map
AA seq 126 aa AA seqDB search
MYHGPNALKVDDVTEPQVRPGTVKLEVGCNGICGTDLCTSTTGWAEGDRVAVEPIYKCDR
CGPCREGNYNVCRQIGFHGLMSDGRYDTTGWVTTIPIGDVVDEGFEALHAGKKMKVLIDP
KGAQRQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccacggaccgaacgcgctgaaggtcgacgacgtcaccgaaccgcaggtgcggccg
ggcaccgtcaagctcgaggtcgggtgcaacgggatctgcggcaccgacctttgcacgagt
actaccggctgggccgaaggagaccgcgtcgcggtcgaaccgatctacaagtgcgatcgg
tgcgggccgtgccgcgagggcaactacaacgtctgccggcagatcggcttccacggcctg
atgtccgacggcaggtacgacaccaccggttgggtgaccacgatcccgatcggcgacgtg
gtcgacgaggggtttgaagcgctgcacgccggcaagaagatgaaggtactgatcgacccg
aaaggagctcaacggcaatga

DBGET integrated database retrieval system