KEGG   Mycolicibacterium vaccae: MYVA_1984Help
Entry
MYVA_1984         CDS       T04356                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00500  Starch and sucrose metabolism
mvq01100  Metabolic pathways
Module
mvq_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYVA_1984
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mvq01003]
    MYVA_1984
Enzymes [BR:mvq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MYVA_1984
Glycosyltransferases [BR:mvq01003]
 Polysaccharide
  Storage polysaccharide
   MYVA_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_1_2 Glyco_trans_4_2 Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: ANI39172
Position
complement(2063625..2064857)
Genome map
AA seq 410 aa AA seqDB search
MKMKILLVSWEYPPVVIGGLGRHVHHLATELVLAGHEVVVLSRRPTGTDPQTHPTTDEVR
EGVRVIAAAEDPHEFTFGTDMMAWTLAMGHAMVRAGLVLADWRPDIVHAHDWLVAQPAVA
LAQFFDVPLVSTIHATEAGRHSGWVSGTVSRQVHALESWLVRDSDSLITCSASMREEITT
LFGPEIAEIAVIPNGIDTDGWPFAARRPRIGPPELLYFGRLEYEKGVHDAIAALPRIRRS
HPGTTLTIAGDGTQLNFLTAQARKHKVLKATNFIGRVDHSELLQLLHRADAAVLPSHYEP
FGIVALEAAATGTPLVTSTAGGLGEAVIDGVTGLSYPAGDVPALAAAVRALLDDPAGAQN
RAVAARERLTSDFAWHTVAADTAQVYLAAKRAERRPQPRRPIVERPLPDR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaagatcctgctggtgtcgtgggagtacccgccggtggtgatcggcgggttg
ggcaggcatgtgcaccatctggccaccgaactcgtcctggccggtcacgaggtcgtcgtg
ctcagccgccgcccgaccggcaccgacccgcagacgcatccgaccaccgacgaggtccgc
gaaggcgtgcgggtgatcgcggccgccgaggatccgcacgagttcaccttcggcaccgac
atgatggcctggaccctggccatggggcacgcgatggtccgcgccggcctggtgctggcc
gactggcgacccgacatcgtgcacgcgcacgactggctggtcgcccagcccgccgtcgcg
ctcgcccagttcttcgacgtcccactggtttccaccatccacgccaccgaggccggccgg
cactccggctgggtctcgggcaccgtcagccgccaggtgcacgcgctggagtcgtggctg
gtgcgggattcggactcgctgatcacgtgttcggcatcgatgcgcgaggagatcaccacg
ctgttcgggcccgagatcgccgagatcgcggtgatcccgaacgggatcgacaccgacggt
tggccgttcgcggcgcggcgcccgcgcatcgggccgcccgagctgctgtacttcggccgc
ctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcgcatccgccgcagc
caccccgggaccacgctgacgatcgccggcgacggcacccaactgaacttcctgaccgcg
caggcacgcaagcacaaggtgctcaaggcgacgaatttcatcggccgcgttgatcattca
gagctgctgcagttgttgcaccgggccgacgcggcggtcctgccctcccattacgaaccg
ttcgggatcgtggcgctcgaagccgccgccaccggcaccccgctggtgacctcgaccgcc
ggcgggctcggcgaggcggtcatcgacggcgtgacggggctgtcttatccggccggcgac
gtgccggcgctggcggccgcggtgcgcgcgctgctcgacgacccggccggcgcgcagaac
cgcgcggtggccgcgcgcgagcgtctgacatcggatttcgcgtggcacacggtggccgca
gacaccgcgcaggtgtacctggccgccaaacgcgccgagcgcaggccccagccgcgacgg
ccgatcgtggaacggccgctgcccgaccggtga

DBGET integrated database retrieval system