KEGG   Mycolicibacterium vaccae: MYVA_4444Help
Entry
MYVA_4444         CDS       T04356                                 

Definition
(GenBank) steroid delta-isomerase
  KO
K16045  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00984  Steroid degradation
mvq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MYVA_4444
Enzymes [BR:mvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     MYVA_4444
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     MYVA_4444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR NmrA adh_short adh_short_C2 DFP NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ANI41532
Position
4647172..4648284
Genome map
AA seq 370 aa AA seqDB search
MGDASLQTDLGRVLVTGGSGFVGANLVTALLDRGLEVRSFDRVPSPLPAHPRLQAVVGDI
TDVADVATAVDGIDTVIHTAAIIDLMGGASVTEEYRQRSFAVNVEGTKNLVHAGQSAGVQ
RFVYTASNSVVMGGQDIVNGDENLPYTTRFNDLYTETKVIAEQFVLSQNGEHGMLTCSIR
PSGIWGRGDQTMFRKVFENVLAGHVKVLVGNRNIKLDNSYVGNLIHGFILAAEHLVPGGT
APGQAYFINDGEPLNMFEFARPVVAACGGKLPDIRVPGKLVHRAMTCWQWLHFKYGIREP
LVEPLAVERLYLNNYFSIGKARRDLGYEPLFSTEQAMAECLPYYVDLFEQMKSEAGRPTV
QAAAPVPPAG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgcatcgctgcagactgacctcggacgcgtcctggtcaccgggggctccggg
ttcgtgggcgccaacctggtcaccgcgcttctcgaccgcggcctggaggtgcgctcgttc
gaccgggtcccgtcgccgctgccggcccacccccgactccaggcggtcgtcggcgacatc
accgacgtcgccgacgtcgccaccgcggtcgacgggatcgacaccgtcatccacaccgcg
gcgatcatcgacctgatgggcggcgcgtcggtcaccgaggagtaccggcagcgcagtttc
gcggtgaacgtcgagggcaccaagaacctcgtccacgccgggcagtccgccggggtgcag
cgcttcgtctacaccgcgtccaacagcgtcgtcatgggcggccaggacatcgtcaatggt
gacgaaaatctgccctatacaacccgtttcaacgatctttacaccgagaccaaggtcatc
gccgaacagttcgtgctgagccagaacggtgagcacggcatgctcacctgctcgatccgg
cccagcggcatctggggccgcggcgatcagacgatgttccgcaaggtgttcgagaatgtc
ctggccggacacgtgaaggtgctcgtcggcaacaggaacatcaagctcgacaattcctat
gtgggcaacctgattcacggattcatcctcgccgccgagcatctggtccccggcgggacg
gccccaggtcaggcgtacttcatcaacgacggcgaaccgctcaacatgttcgagttcgcg
cgccccgtggtcgcggcctgcggcggcaaactgcccgacatccgggtgcccggaaagctg
gtgcacagggcgatgacctgctggcagtggttgcacttcaagtacggcatccgcgagccg
ctggtcgaaccgcttgcggtggaacggctttacctgaacaactacttctcgatcggcaag
gcccgccgcgatctcgggtatgagccactgttcagcaccgaacaagccatggccgaatgc
ctgccgtactacgtcgaccttttcgagcagatgaagagtgaagccggccgacccaccgtg
caggccgccgccccggtgccgccggcaggctga

DBGET integrated database retrieval system