KEGG   Mycolicibacterium vaccae: MYVA_4758Help
Entry
MYVA_4758         CDS       T04356                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00071  Fatty acid degradation
mvq00072  Synthesis and degradation of ketone bodies
mvq00280  Valine, leucine and isoleucine degradation
mvq00310  Lysine degradation
mvq00362  Benzoate degradation
mvq00380  Tryptophan metabolism
mvq00620  Pyruvate metabolism
mvq00630  Glyoxylate and dicarboxylate metabolism
mvq00640  Propanoate metabolism
mvq00650  Butanoate metabolism
mvq00900  Terpenoid backbone biosynthesis
mvq01100  Metabolic pathways
mvq01110  Biosynthesis of secondary metabolites
mvq01120  Microbial metabolism in diverse environments
mvq01130  Biosynthesis of antibiotics
mvq01200  Carbon metabolism
mvq01212  Fatty acid metabolism
mvq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mvq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYVA_4758
   00630 Glyoxylate and dicarboxylate metabolism
    MYVA_4758
   00640 Propanoate metabolism
    MYVA_4758
   00650 Butanoate metabolism
    MYVA_4758
  Lipid metabolism
   00071 Fatty acid degradation
    MYVA_4758
   00072 Synthesis and degradation of ketone bodies
    MYVA_4758
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYVA_4758
   00310 Lysine degradation
    MYVA_4758
   00380 Tryptophan metabolism
    MYVA_4758
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYVA_4758
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYVA_4758
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MYVA_4758
Enzymes [BR:mvq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MYVA_4758
Exosome [BR:mvq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYVA_4758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Dodecin
Motif
Other DBs
NCBI-ProteinID: ANI41828
Position
4950055..4951275
Genome map
AA seq 406 aa AA seqDB search
MSSTTGVWILGGHQSDFARNYARDGLDFAGLTAEIVEATLHEAKLDAEDIGVVHVANAFG
EMFARQGHLGAMPATVNAGLWGTPAVRHEAACASGSVATLAALADLRSGAYSTALVVGVE
LEKTVPGDTATSILGAAAWTGHEGLDAKYMWPHMFEAVAAEYDRRYGLDESHLHAIAALN
YANAKANPRAQTRDWSVPDPGTADDVTNPVVEGRLRRLDCSQLTDGGAGVVLVTDDWLRQ
HPGARPLGRIDGWGHRTVGLGLQQKLDHSAGEPYVLPHVREAVHDAFGRARVTLDDIDGF
EVHDCFSPSEYLAIDHIGLTGPGESWKAIEQGEIEIGGRLPINPSGGLIGGGHPVGASGV
RMLLDAARQVSGTAGGYQVDDAKTFATLNFGGSTATTVSFVVGRTP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcacgaccggcgtgtggatcctgggcggccaccagagcgacttcgcgcgcaac
tacgcccgggacgggctggatttcgcgggcctgaccgccgagatcgtcgaggcgacgctg
cacgaggcgaagctcgacgccgaggacatcggcgtcgttcatgtcgccaacgcgttcggc
gagatgttcgcccgccagggccacctcggcgccatgcccgcgaccgtcaacgcaggtctg
tggggcactccggcggtgcgccacgaagcggcatgcgcgtcgggcagcgtcgcgacgctg
gccgcgctcgccgatcttcggtcgggcgcgtactccacggcgctggtggtcggcgtggag
ttggagaagacggtccccggtgacaccgcgacctcgatcctcggggcggcggcctggacc
gggcacgagggcctggacgcgaagtacatgtggccgcacatgttcgaggccgtcgccgcg
gagtacgaccggcgctacggcctcgacgaatcccatctgcatgccatcgcggcgctgaac
tacgccaacgccaaggccaacccgcgggcacaaacccgggactggtcggtcccggatccg
ggcaccgccgacgacgtcaccaatcccgtggtcgagggcaggcttcgccgcctcgactgc
agccagctcaccgacggcggcgccggcgtcgtcctggtcaccgacgactggctgcgccag
caccccggcgcgcgccccctgggccgcatcgacggctggggacatcgcaccgtcggcctg
ggattgcagcagaagctggaccactccgcgggcgaaccctacgtgctgccccatgtgcgc
gaggccgtgcacgacgccttcggccgcgcccgcgtcaccctcgacgacatcgacggtttc
gaggtgcacgactgcttcagcccgagcgagtacctggccatcgaccacatcgggctgacc
gggccgggcgaatcgtggaaggcgatcgagcagggcgagatcgagatcggcggccgcctg
cctatcaatcccagcggcggcctgatcggtggcgggcacccggtcggcgcgtccggggtg
cggatgctgctggacgcggcgcgtcaggtcagcggcaccgccggcggctaccaggtcgac
gacgcgaagaccttcgccaccttgaacttcggcggcagcaccgccaccaccgtcagcttc
gtcgtcggaaggaccccgtga

DBGET integrated database retrieval system