KEGG   Mycolicibacterium vaccae: MYVA_5217Help
Entry
MYVA_5217         CDS       T04356                                 

Definition
(GenBank) 4,5-9,10-diseco-3-hydroxy-5,9, 17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00984  Steroid degradation
mvq01100  Metabolic pathways
mvq01120  Microbial metabolism in diverse environments
mvq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MYVA_5217
Enzymes [BR:mvq01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     MYVA_5217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Esterase DUF1100 DUF915 Abhydrolase_3 Peptidase_C42
Motif
Other DBs
NCBI-ProteinID: ANI42269
Position
complement(5442422..5443321)
Genome map
AA seq 299 aa AA seqDB search
MTSFAAEAAQQQEITFESTSRFADVSGKGQDMRLHYHEAGVGHSETVVLLHGGGPGASSW
SNFSKNIAVLAKHFHVLAVDQPGYGLSDKHTEHEQYNRYSANALLNLFDHLGIERAALVG
NSLGGGTAVRFALDNPKRAGRLVLMGPGGLSVNLFAPDPTEGVKLLGKFAAEPTRENIEK
FLRIMVWDQSLITPELVEERFQIASTPESLAATRAMGKSFAGADFELGMMWRDVYKLRQR
VLLIWGREDRVNPLDGALVALKQIPRVQLHVFGQCGHWAQLEKFDEFNKLTIDFLGGAS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctttcgcagccgaagcggcccagcagcaagagatcacgttcgagtcgacctcg
cggttcgccgacgtcagtggcaaaggtcaggacatgcgcctgcactaccacgaggccggg
gtcgggcattccgagacggtggtgctgctgcacggcggcggtcccggtgcctccagctgg
tcgaacttctcgaagaacatcgcggtgctggccaagcacttccacgtgctggccgtcgac
cagcccggctacgggctctccgacaagcacaccgagcatgagcagtacaaccgctacagc
gccaacgcgttgctgaacctgttcgaccatctcggcatcgaacgggctgcgctggtgggc
aattcgctcggcggcggcacagcggtgcgattcgcgctggacaacccgaagcgggccggg
cgcctggtgctgatgggcccgggcgggctgagcgtcaacctgttcgcaccggacccgacc
gagggcgtcaagctgctcggcaagttcgccgccgaaccgacgcgggagaacatcgagaag
ttcctgcgcatcatggtctgggatcagagcctgatcacgcccgagttggtcgaggagcgc
ttccagatcgccagcacgccagagtcgctggcggccaccagggcgatgggcaagtcgttc
gccggcgccgatttcgagctgggcatgatgtggcgcgacgtgtacaagctgcgccagcgg
gtactgctgatctggggtcgcgaggaccgcgtcaacccactcgacggggcgctggtggcg
ctgaagcagattccgcgggtgcagttgcacgtcttcggacagtgcggccactgggctcag
ctggagaaattcgacgagttcaacaagctgaccatcgacttcttgggaggcgcatcatga

DBGET integrated database retrieval system