KEGG   Mannheimia sp. USDA-ARS-USMARC-1261: X781_13050Help
Entry
X781_13050        CDS       T03026                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mvr  Mannheimia sp. USDA-ARS-USMARC-1261
Brite
KEGG Orthology (KO) [BR:mvr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    X781_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHG73453
UniProt: W0Q898
Position
1320019..1321284
Genome map
AA seq 421 aa AA seqDB search
MELINNYGFIIVVITAVFGFIMAFGIGANDVANAMGTAVGSRTITAKQAIYIALVFEFFG
AYLAGGEVAETIKSGIISTDAFIGRPDILILGMMSALFAAGIWLVVASQKGWPVSTTHSI
IGAIVGFAIVSVGMEAVQWGQFGGIVGSWFITPFIAGVVAYLIFVSTQRMIFDTENPMAN
AEKYAPYYTALTVFIICIVTLEKGLKHVGLDLSGLQTALLSAAISVVCAIICVFYLRSNA
FKASLKENSTFSGVEKVFSILMLITACAMAFAHGSNDVANAIGPLAAVVSIVDHGGVIEG
KTIMAPWVLPLGAVGIAVGLAVMGHKVMGTIGTGITDLTPSRGFAAQFACSATVVIASGT
GLPISTTQTLVGAVIGVAFARGIAALNLSVIRNIIASWVITLPAGALLSIVIYYILSAIF
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaactgattaacaactacggttttattattgttgtcattacagccgtttttggtttt
attatggcatttggtattggtgcaaatgacgttgcaaatgcaatgggaactgctgttggc
tctcgcaccattaccgcaaaacaagcaatctatattgcgttagttttcgagttttttgga
gcttaccttgccggtggtgaagtagctgaaacaattaaaagcggtattatttcaactgat
gctttcattggtcgcccggatattctcattctaggtatgatgtcagccctttttgctgca
ggtatctggttagttgtagcctcacaaaaaggttggcctgtttctactacccactcaatt
atcggtgctattgtgggttttgctatcgtatctgtaggtatggaagcagtacaatgggga
caatttggcggtattgtgggtagctggtttattacgccatttattgctggtgttgttgcc
taccttatctttgtgtctacacaaagaatgatttttgatactgaaaacccaatggcaaat
gctgagaaatatgctccttattatacagctctaacagtatttattatttgtatcgttacg
ctagaaaaaggcttaaaacacgttggtttagatcttagtggtttacagacggctcttctt
tccgctgcaatttctgtagtttgtgccattatttgtgtgttttatcttcgtagtaatgct
ttcaaagcaagcttaaaggaaaactctacatttagcggtgtagaaaaagtattcagcatt
ttaatgctgattactgcttgtgcaatggctttcgcacacggttcaaatgacgttgctaat
gctatcggtcctttagctgcagtggtttctattgttgatcacggcggtgtaattgaaggt
aaaacaattatggctccttgggttttaccattaggtgcagtaggtattgcagttggtctt
gcggtaatgggtcataaagtaatgggtactatcggcacaggtattactgatttaacacca
agtcgtggttttgcagctcagtttgcttgttcagctacagtagtaattgcatccggtaca
gggcttccaatttctacaacgcaaacacttgtaggtgcagttattggtgtagcttttgca
cgaggtattgcggcattaaacctgagcgtaattcgtaatatcatcgcgtcttgggtaatt
actttaccggcaggggcattgctatccattgtgatttactatatcttaagtgcaattttt
cattaa

DBGET integrated database retrieval system