KEGG   Mannheimia sp. USDA-ARS-USMARC-1261: X781_1860Help
Entry
X781_1860         CDS       T03026                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
mvr  Mannheimia sp. USDA-ARS-USMARC-1261
Pathway
mvr00540  Lipopolysaccharide biosynthesis
mvr01100  Metabolic pathways
Module
mvr_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:mvr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    X781_1860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:mvr01005]
    X781_1860
Enzymes [BR:mvr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     X781_1860
Lipopolysaccharide biosynthesis proteins [BR:mvr01005]
 Unusual sugar
  X781_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: AHG72336
UniProt: W0Q1E1
Position
complement(197600..198529)
Genome map
AA seq 309 aa AA seqDB search
MIIVTGGAGMIGSNIIKALNEIGRRDILVVDNLKNGEKFINLVDLDIADYCDKEDFIASI
IAGDDFGEIDAVFHQGACSATTEWDGKYLMQNNYEYSKELLHFCLDRQIPFFYASSAATY
GGRSDNFIEKREFESPLNAYGYSKFLFDEYVRSILPEADSPVCGFKYFNVYGPREQHKGS
MASVAFHLNNQMLKGENPKLFAGSEQFLRDFVYVEDVAKVNLWAWQNGVSGIFNLGTGKA
ESFEEVANAVIKYHGRGEIETIPFPEHLKSRYQTFTQADLTNLRAAGYTGKFKTVAEGTA
EYMVWLNRK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtaaccggtggtgccggaatgatcggcagcaatattatcaaagcgttaaat
gaaatcggtcgtagagatattttagtggtagataacctgaaaaatggcgaaaaatttatc
aatttagtggatttagatattgccgactactgcgataaagaagattttattgcttctatt
attgctggtgatgattttggcgagattgatgcggttttccatcaaggtgcttgctcggca
accaccgagtgggatggcaaatacttaatgcaaaataactacgaatattcaaaagagtta
ttgcatttctgcctggatcgacaaattccgtttttctatgcctcaagtgctgcaacttac
ggtggacgctctgataatttcatcgaaaaacgtgaatttgaaagtccgttaaatgcctac
ggatactcaaaattcctatttgacgaatatgtccgcagcatcttaccggaagccgattcg
ccggtttgtggattcaaatacttcaacgtttacggacctcgtgaacaacacaaaggttcg
atggcaagtgtagcgttccatctcaataatcaaatgctaaaaggcgaaaacccgaaatta
ttcgcaggttctgagcagttcttgcgtgattttgtttatgtagaagatgtggcaaaagtc
aatctttgggcgtggcaaaacggtgtatcgggcattttcaaccttggaacaggtaaagca
gagtcatttgaagaagtggcaaatgcggtaatcaaataccatggcagaggcgaaattgaa
acaatcccattcccggaacacttaaaatctcgctaccaaactttcacacaagcagatctc
acgaacttacgagctgccggctacacaggtaaatttaaaactgtggcagaaggtacggcg
gagtatatggtttggttgaatcgtaagtaa

DBGET integrated database retrieval system