KEGG   Mannheimia sp. USDA-ARS-USMARC-1261: X781_640Help
Entry
X781_640          CDS       T03026                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mvr  Mannheimia sp. USDA-ARS-USMARC-1261
Pathway
mvr00051  Fructose and mannose metabolism
mvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    X781_640
Enzymes [BR:mvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     X781_640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHG72214
UniProt: W0PZU9
Position
70456..71595
Genome map
AA seq 379 aa AA seqDB search
MNALHFGAGNIGRGFIGKLLADSGVFVTFADINQTQIDQINQNKQYGVKIVGDASRVEMV
KNIAAINSKDEAAVIEQVKTVDLITTAVGPNVLGFIAPLFAKALVARVESGNTQPLNIIA
CENMVRGTTFFKGKIFENLTAEQQAEVEKLVGFVDSAVDRIVPPAELNENDPLEVTVEEF
SEWIVDKTQFKGSIPDIKGMELTDNLMAFVERKLFTLNTGHLICAYLGKQAGVQWIKEAI
AIDEIKAQVKATMEESGTVLIKRYGFDAQAHAAYIEKILKRFANPYLNDDVNRVGREPIR
KLSPNDRLIKPLSGTLEYGLPHSNLVNGVVMALQYRNEEDPQAVELSQFIANHGVAAAVE
KYTGLTDQAVIAKVVGLYQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactccatttcggtgcaggcaatatcggacgtggctttatcggtaaattattg
gcagatagcggcgtgttcgttacttttgctgatattaaccaaactcaaattgaccaaatc
aaccaaaacaaacagtatggcgtgaaaattgtgggcgatgcaagccgtgttgaaatggtt
aaaaatattgcggcgatcaattctaaagatgaagcggcagtgattgaacaagttaaaaca
gttgatttaattaccactgccgttggtccaaacgtattaggctttatcgccccacttttt
gcaaaagcactagtggctcgtgtggaaagcggtaatactcaaccgttaaacattattgcc
tgtgaaaatatggtgcgtggtacaacgttctttaaaggcaaaatttttgaaaacttaact
gctgagcaacaagcagaagtggaaaaattggtcggttttgtggattctgcggtagataga
attgtgccaccggcagagctaaacgaaaacgatccgcttgaagtaacggttgaagaattt
agtgaatggattgtggataaaactcaatttaaaggctcaattccagatattaaaggaatg
gaattaaccgataacctaatggcatttgtggagcgtaaattatttacgcttaacacaggg
catttaatttgtgcttatttaggtaaacaagctggtgtgcaatggatcaaagaagcaatc
gcaattgatgaaatcaaagcccaagttaaagccacaatggaagagagcggtacggtgcta
attaagcgttacggcttcgatgcacaagctcacgctgcctacatcgagaaaattcttaaa
cgtttcgccaacccatacttaaatgatgatgtaaaccgtgtcggtcgtgagccaatccgc
aaactcagcccgaatgaccgtttaattaagccactttcaggcacattagaatatggttta
ccacacagcaacttagtgaatggcgtggtaatggcgttgcaatatcgtaatgaagaagac
ccacaagcggtcgaattgagccaatttattgcaaatcacggtgtagccgcagcagttgag
aaatacaccggtttaaccgaccaagctgtgattgcgaaggttgttgggttatatcagtaa

DBGET integrated database retrieval system