KEGG   Mannheimia sp. USDA-ARS-USMARC-1261: X781_7900Help
Entry
X781_7900         CDS       T03026                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mvr  Mannheimia sp. USDA-ARS-USMARC-1261
Pathway
mvr00071  Fatty acid degradation
mvr00072  Synthesis and degradation of ketone bodies
mvr00280  Valine, leucine and isoleucine degradation
mvr00310  Lysine degradation
mvr00362  Benzoate degradation
mvr00380  Tryptophan metabolism
mvr00620  Pyruvate metabolism
mvr00630  Glyoxylate and dicarboxylate metabolism
mvr00640  Propanoate metabolism
mvr00650  Butanoate metabolism
mvr00900  Terpenoid backbone biosynthesis
mvr01100  Metabolic pathways
mvr01110  Biosynthesis of secondary metabolites
mvr01120  Microbial metabolism in diverse environments
mvr01130  Biosynthesis of antibiotics
mvr01200  Carbon metabolism
mvr01212  Fatty acid metabolism
mvr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X781_7900
   00630 Glyoxylate and dicarboxylate metabolism
    X781_7900
   00640 Propanoate metabolism
    X781_7900
   00650 Butanoate metabolism
    X781_7900
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X781_7900
   00072 Synthesis and degradation of ketone bodies
    X781_7900
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X781_7900
   00310 Lysine degradation
    X781_7900
   00380 Tryptophan metabolism
    X781_7900
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X781_7900
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X781_7900
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X781_7900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mvr04147]
    X781_7900
Enzymes [BR:mvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X781_7900
Exosome [BR:mvr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X781_7900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG72938
UniProt: W0Q6T6
Position
complement(832442..833623)
Genome map
AA seq 393 aa AA seqDB search
MKNVVIASAVRTAIGSFGGSLAGVSAVELGTSVIKSAIEKSGIDIGIVDEVIMGNVLQAG
LGQNPARQALLRAGIAQEVPAYTVNKVCGSGLKAVALAAQAIKAGDANIIVAGGMENMSQ
APYLLDSKSRWGYRLGDAKVQDVILSDGLMCAENNYHMGITAENVAKKYGITREMQDELA
LASQQKATAAIQSGAFKNEIVPLNIKIKRKDVVFDTDEFVKQDSTLDALAGLRTAFDKEG
TVTAGNASGINDGAAALVIVEEETAKALGLNILARVKGYASGGVAPDIMGMGPVPATLNA
LKKTGLQLSDIDLIEANEAFAAQFLAVGKELGFDPEKVNVNGGAIALGHPIGASGARILV
TLLHSMHARDKQFGLATLCIGGGQGIAMIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtcgttattgcaagtgcggtacgtaccgctatcggtagttttggtggttct
ttagccggtgtatccgcagttgagctgggtacaagtgtcattaagtcagcgattgaaaaa
tcaggtattgatattggtatcgttgatgaagtgattatgggtaatgttttgcaagcaggt
cttggacaaaatcctgcacgtcaagcgttattacgagcgggaattgcacaagaagttcct
gcttataccgttaataaggtatgtggttcaggcttaaaagcggtggcgttagctgcacag
gcaattaaagcgggtgatgccaatatcattgtcgcaggtggtatggaaaatatgagccaa
gctccatacttattagattctaaatctcgctggggctatcgtttaggtgatgcgaaagtt
caagatgtgattttatccgatggtctaatgtgtgctgaaaataactatcatatgggaatt
actgctgaaaatgtagcaaaaaaatatggtatcactcgtgaaatgcaagatgaattagct
cttgcctctcaacaaaaagccaccgcagcaattcaatcaggtgcattcaaaaatgaaatc
gtgccattaaatatcaagatcaaacgtaaagacgttgtttttgatactgatgagttcgta
aaacaagattcaacgcttgatgctctagcggggctccgtactgcgtttgataaagaaggt
acggttactgcaggtaatgcctcaggtatcaacgatggtgcggcagcattagttatcgtg
gaagaagaaactgcaaaagcattaggtttgaatattcttgctcgtgtgaaaggttacgca
agcggtggtgttgctccggatattatgggaatgggacctgttcctgcgactttaaatgca
ttgaaaaaaacaggcttacagttaagtgatattgacttaattgaagcaaatgaagccttt
gcagcacaattcttagcagttggcaaagaattaggttttgatcctgaaaaagtaaatgta
aatggtggtgctattgcacttggtcacccaattggtgcgagtggtgctcgtatcttagtt
accttattacactcaatgcatgcacgtgataaacaatttggtttagcaacattatgtatt
ggtggtggtcaaggcattgcaatgattgttgaacgtatttaa

DBGET integrated database retrieval system