KEGG   Moritella viscosa: MVIS_3538Help
Entry
MVIS_3538         CDS       T03770                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mvs  Moritella viscosa
Pathway
mvs00360  Phenylalanine metabolism
mvs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mvs00790  Folate biosynthesis
mvs01100  Metabolic pathways
mvs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MVIS_3538 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MVIS_3538 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MVIS_3538 (phhA)
Enzymes [BR:mvs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     MVIS_3538 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: CED61444
UniProt: A0A090IM26
Position
1:4028227..4029045
Genome map
AA seq 272 aa AA seqDB search
MNSSLAIDPTPKYVSHKPDQHGYINYSDEEHNTWATLYNRQTRVIKDRACDEFIAGIELL
RMGADRIPQLPDINRKLKKLTGWQVENVPALIGFERFFELLATKRFPAATFIRTKADIDY
IQEPDIFHELFGHCPLLTNQAYADFSQHYGELGLKADKVDRPMLARLYWFTIEFGLMQSD
QGLKIFGGGILSSKEETRYSLDSDIPNRQPLQVIEAFRTHYRIDELQKNYFVINQLSDLQ
QLIKLDLITLIKEARILGMKPSAYTPKEDAAC
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaactcatctttagcaattgacccgacaccaaaatatgtttcacacaagccagatcaa
cacgggtacatcaattatagcgatgaggaacacaatacttgggcgacgctctacaatcgt
caaacacgtgttattaaagaccgtgcctgtgatgaatttatcgcgggtattgaactactg
agaatgggcgcagaccgcattccacaattaccggatatcaaccgtaagctaaagaaatta
acgggttggcaagtcgaaaatgtccctgctttaattggttttgaacgtttttttgaatta
ctagcaactaaacgttttccggccgcgactttcattcgtaccaaagccgacatagactac
attcaagaaccggatatttttcatgaattatttggtcactgcccactactcaccaatcaa
gcttatgctgatttttctcagcattacggtgaactgggtttaaaagccgacaaagtagat
cgccctatgctggcacgcttgtactggtttacgattgagtttggtttaatgcaaagcgac
caaggcttgaagatctttggcggtggaattttgtcatctaaagaagaaacgcgctacagc
ttagacagcgatattcccaaccgtcaaccactgcaagtgatagaagcatttcgaactcat
taccgtattgatgagttacaaaagaattactttgtgattaaccagctatccgatttacaa
caattaattaagctcgatttaattaccttgataaaagaagccagaatattaggcatgaaa
ccttcggcttatacaccaaaagaagatgcggcttgttaa

DBGET integrated database retrieval system