KEGG   Moritella viscosa: MVIS_3654Help
Entry
MVIS_3654         CDS       T03770                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mvs  Moritella viscosa
Pathway
mvs00620  Pyruvate metabolism
mvs00630  Glyoxylate and dicarboxylate metabolism
mvs01100  Metabolic pathways
mvs01110  Biosynthesis of secondary metabolites
mvs01120  Microbial metabolism in diverse environments
mvs01200  Carbon metabolism
Module
mvs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MVIS_3654 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MVIS_3654 (aceB)
Enzymes [BR:mvs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MVIS_3654 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CED61556
UniProt: A0A090IH19
Position
1:complement(4160640..4162256)
Genome map
AA seq 538 aa AA seqDB search
MTANTQSNETGSLVFHGEINQEQQQILNPEAVALLTELVEKFAPQVDELLNQRVKKQARM
DAGELPDFLPETAHIREGDWKIQGIPAKLQDRRVEITGPVDRKMVINALNARVKVFMADF
EDSFAPTWGGVLDGQVNLRDAVNGTIEYTNPANGKHYSLDDDPATLICRVRGLHLPEKHI
TFNGKIVPGCLVDFALYFSNNYETLLAKGAGPYFYVPKLQSHHESKWWSEVFSYAEDKVN
LDRGTIKATLLIETIPAVFEMEEILYSMKEHIVALNCGRWDYIFSYIKTLRKHADRVLPD
RHSVTMDKSFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKTAEENDKVLAKVTADKTLEA
KNGHDGTWVAHPGLADTAMDVMNEYIGAGNANQINVLRENDAPVTAAELLEPCSGERTET
GMRLNIRIGVRYMEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKTLSNGKIVTK
ELFCQLLQEELLVIRDEEIGVEAYEQGRFVEASKLFEELTVSDHLAEFLTLPGYDFLD
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaatacccagtctaatgaaacaggttctctggttttccatggggaaatcaac
caagaacaacaacagatcctaaatcctgaagcagttgctttgttgactgagttagtcgaa
aaattcgcacctcaagttgatgagctacttaatcaacgtgtaaaaaaacaagcgcgtatg
gatgctggtgaactccctgattttttacctgaaacggcacatattcgcgaaggcgattgg
aagattcaaggtatccctgcaaaacttcaagatcgtcgtgtagaaattactggtccagtt
gaccgaaagatggtgattaatgcactaaacgcacgcgttaaagtatttatggcagacttt
gaagattcattcgcgccaacatggggcggtgtgttagacggtcaggttaacttacgtgat
gcagtaaatggtacgattgaatatactaaccctgcgaacggtaaacactactctttagat
gatgatccagcaacacttatctgtcgtgttcgtggtctgcatttaccagaaaaacatatt
acttttaacggtaaaattgtaccgggttgtttagtcgattttgcactgtatttttctaat
aactatgaaacgttattagcaaaaggcgcaggcccttacttctacgtacctaagctgcaa
agccaccatgaatcaaaatggtggagtgaagtatttagctatgcagaagacaaagtaaat
ctagaccgcggtacaatcaaagctacactgctcattgaaactatccccgctgtattcgaa
atggaagaaattctatatagcatgaaagagcacattgttgcgcttaactgtggtcgttgg
gattatatttttagctatattaaaacactgcgtaaacatgcagatcgtgtattaccagat
cgtcattctgtaacgatggacaaatctttccttagtgcttattcacgtttattaatcaaa
acatgtcataaacgtggcgctcttgcaatgggcggtatggctgcatttattccagccaaa
acagctgaagaaaacgataaagtattagctaaagtaaccgcagataagaccctggaagca
aaaaatggtcatgacggtacttgggttgctcaccctggtttagcagatactgcaatggat
gtgatgaacgaatatatcggtgcaggtaatgctaaccaaattaacgttttacgtgaaaac
gatgcaccggtaacggctgctgagttacttgaaccttgttctggtgaacgaactgaaacg
ggtatgcgtttaaatattcgtattggtgttcgctacatggaagcatggatttcgggtaat
ggttgtgtgcctatctacggcttaatggaagatgcagcaaccgcagaaatctctcgtgcg
tcaatttggcagtggatccagcacggcaaaacattgagcaacggtaaaattgtaacaaaa
gagttattctgccaattactacaagaagagcttctggtcattcgtgatgaagaaattggt
gttgaagcttacgagcaaggccgttttgttgaagcgtctaaattgtttgaagaattaaca
gtcagcgatcaccttgctgagtttttaacgctgcctggttatgatttcttagattag

DBGET integrated database retrieval system