KEGG   Moritella viscosa: MVIS_3793Help
Entry
MVIS_3793         CDS       T03770                                 

Definition
(GenBank) probable aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mvs  Moritella viscosa
Pathway
mvs00130  Ubiquinone and other terpenoid-quinone biosynthesis
mvs00627  Aminobenzoate degradation
mvs01100  Metabolic pathways
mvs01110  Biosynthesis of secondary metabolites
mvs01120  Microbial metabolism in diverse environments
mvs01220  Degradation of aromatic compounds
Module
mvs_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:mvs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MVIS_3793
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MVIS_3793
Enzymes [BR:mvs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     MVIS_3793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DUF3439
Motif
Other DBs
NCBI-ProteinID: CED61686
UniProt: A0A090IHB9
Position
1:complement(4320231..4320854)
Genome map
AA seq 207 aa AA seqDB search
MKTKTAEFSKRITLGISGASGSQYAVRLLELLLAADVQVHLLMSDAAKVVMATETDEKWP
ADNKALQLFLTDKYQAKAEQLFVPSSKDWFSPVASGSGAPKQMVICPCSMGTVAAVAQGM
STNLLHRAADVVLKERGQLVLIPRETPLSPIHLENMLKLSRLGVTIMPAAPGFYRKPKTL
DDLIDLMVARILDHLDVDQSIYAGWGR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaaacggctgaatttagcaaacgcattaccttagggatcagtggtgcgtca
ggctcacaatatgcggtacgtttattagaattattattagcggcggatgtgcaagtacat
ttgttgatgtcggatgctgctaaagtggtaatggcaactgaaactgatgaaaaatggcct
gcagacaataaagcactacagttattcttaacggataaataccaagcgaaagcagaacag
ttattcgtaccaagcagcaaagattggttctcgcctgtcgcatcgggttcaggtgcgcca
aaacaaatggtgatctgtccatgtagtatgggaaccgtagcggctgtggcacaaggtatg
tcgaccaacttattacatcgtgctgctgacgtggtattaaaagaacgtggtcaactggta
ctgattcctcgtgaaacgccattatcaccaattcatttagaaaatatgctgaaattgtct
cgtctaggggtcactatcatgccagctgcgccgggtttttaccgaaaaccgaaaacgctt
gatgatctcattgatttgatggtcgctcgtattcttgaccatttggacgttgaccaatct
atttatgcaggttggggccgttaa

DBGET integrated database retrieval system