KEGG   Methanocaldococcus vulcanius: Metvu_0470Help
Entry
Metvu_0470        CDS       T01105                                 

Definition
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mvu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Metvu_0470
Enzymes [BR:mvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Metvu_0470
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Metvu_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Trp_halogenase FAD_oxidored HI0933_like GIDA FAD_binding_2 Pyr_redox_2 Lycopene_cycl DAO Thi4 NAD_binding_8 SE Pyr_redox_3 Big_3_4
Motif
Other DBs
NCBI-ProteinID: ACX72329
UniProt: C9RFH7
Position
451962..453137
Genome map
AA seq 391 aa AA seqDB search
MRELKDSYDVVVVGAGPGGSMASYATAKNGVKTLLIEKSQEIGEPVRCAEAIPSIEEFGI
KPSPEFVRNIIKGGILFSPSGKKVVVTQGKAQGFVVERKIFDKYLAVRAGRAGAKIAVKS
TVVGLERDGDYWNVIVEFLGEEYVIKTKIVIAADGVESNVAEYAGLKAKKKPLDICSCAE
YEMTNVELFDKNMMEFYFGNDVAKGGYAWIFPKGETANVGLGVRDKKKKAIDYLEEFIEN
SLASDKLKNATPVEFKVGGAPVSGPIEKTYADGILVVGDAAGQISPLTGGGIYLAMDCGL
MAGEVASKSIKSNNWSEDVLKEYERLWKEKHYEYLLNHLKYRKILEKLSDDELDALAEAL
GDNLDGIDLKKFVKRIITKKPSLLKYFKDLI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagagttaaaggatagttatgatgttgtggttgttggagcagggcctggaggaagt
atggcgagttatgctactgcaaaaaatggagtaaaaactcttttaattgaaaaatctcag
gaaattggagaaccagtaagatgtgccgaggcaattccatcaattgaggaatttggaata
aaaccaagtcctgagtttgttagaaacattattaaaggagggattcttttttctccgtct
ggaaagaaggttgttgttacacagggtaaagcacaggggtttgttgttgaaagaaagatc
tttgataagtatttggcagttagagctggtagggcaggagcaaagattgctgtgaagtca
actgttgtaggtttggagagagatggagattattggaatgttatagttgagtttttagga
gaggagtatgttattaaaacaaagattgtgatcgctgccgatggtgttgaaagtaatgtg
gcagaatatgccggattaaaagcaaaaaagaaaccattggatatatgttcttgtgctgag
tatgagatgacaaatgttgagttgtttgataaaaatatgatggagttttactttggaaat
gatgtagcgaaagggggttatgcttggatattccctaagggagaaacagcaaatgttgga
ttaggtgttagggataaaaaaaagaaggcaattgattacttggaggaatttatagagaat
agtttagcaagtgataaactaaaaaacgctactcctgtggaatttaaagttggtggagcc
cctgtttctgggccaatagaaaaaacctatgctgatgggattttggttgttggagatgct
gcaggacagataagccctttaactggtggtggtatttatttagcgatggattgcggattg
atggctggagaagtggcaagtaaatctataaagtcaaataattggagtgaggatgtttta
aaagaatatgagaggttatggaaagagaagcattatgagtatttgcttaatcatttaaag
tataggaaaatcttggaaaaactttctgatgatgaattagatgctcttgcggaagcgtta
ggggataatttagatggtattgatttaaaaaagttcgtaaagaggataataacaaaaaag
ccatctcttttaaagtatttcaaggatcttatttaa

DBGET integrated database retrieval system