KEGG   Methanocaldococcus vulcanius: Metvu_1157Help
Entry
Metvu_1157        CDS       T01105                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00010  Glycolysis / Gluconeogenesis
mvu00020  Citrate cycle (TCA cycle)
mvu00620  Pyruvate metabolism
mvu00633  Nitrotoluene degradation
mvu00640  Propanoate metabolism
mvu00650  Butanoate metabolism
mvu00680  Methane metabolism
mvu00720  Carbon fixation pathways in prokaryotes
mvu01100  Metabolic pathways
mvu01120  Microbial metabolism in diverse environments
mvu01130  Biosynthesis of antibiotics
mvu01200  Carbon metabolism
Module
mvu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mvu_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_1157
   00020 Citrate cycle (TCA cycle)
    Metvu_1157
   00620 Pyruvate metabolism
    Metvu_1157
   00640 Propanoate metabolism
    Metvu_1157
   00650 Butanoate metabolism
    Metvu_1157
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metvu_1157
   00680 Methane metabolism
    Metvu_1157
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metvu_1157
Enzymes [BR:mvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metvu_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF1425
Motif
Other DBs
NCBI-ProteinID: ACX73015
UniProt: C9RHG3
Position
1136753..1137292
Genome map
AA seq 179 aa AA seqDB search
MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RCQIYEPDYVIVQDPTLLESVNVVDGLKENGAVIINTVKEDLDLGYKTYTIDATGIALDV
LGVPIVNTAMVGAFAGVTKLVSIESVKKAILDTFKGKLGEKNAKAAELAYNEMIKKYGK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagttaggtttcatgggcgaggagggcaaggggcagttactgctgctcaaatt
ttagcaaaggcctcattttacgatggaaaattttgccaagcgtttccgttttttggtgtt
gagagaagaggagctccagttatggcatttacaagaatagatgataaaaagatcacacta
agatgtcaaatatatgagccggactatgttattgtccaagatcctacacttttggagagt
gtgaatgttgttgatggattaaaggagaatggggcagttattataaataccgttaaagaa
gatctggatttaggatacaaaacctatacaatagacgcgacagggatagcgttagatgtt
ttaggagttcctattgttaatactgcgatggttggtgcttttgcaggagttacaaaactt
gttagcattgaatcagtaaaaaaagcaattttagatacatttaaaggtaaattaggagaa
aaaaacgcaaaagcagctgaattggcatacaacgaaatgatcaaaaaatatggaaaataa

DBGET integrated database retrieval system