KEGG   Microcystis viridis: myaer102_24180Help
Entry
myaer102_24180    CDS       T06032                                 

Definition
(GenBank) nitrilase homolog
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mvz  Microcystis viridis
Brite
KEGG Orthology (KO) [BR:mvz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    myaer102_24180
Enzymes [BR:mvz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     myaer102_24180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: BBH39874
UniProt: A0A3G9JZZ9
Position
2581277..2582095
Genome map
AA seq 272 aa AA seqDB search
MKSYLAAAIQMTSQPDLEKNLAAAEELIELAVGKGAELIGLPENFAFMGAETDKIAQAET
IARKADKFLRTMAQRFQVTILGGGFPVPVTGIPDKAYNTAILVDGNGAELARYQKVHLFD
VNVPDGNTYQESSTVMAGIDLPPIYGSDSLGKIGLSICYDVRFPELYRYLSRQGADVLFV
PAAFTAFTGKDHWKVLLQARAIENTCYIIAPAQTGNNYERRYTHGHAMIIDPWGVVLADA
GEEAGVAIAEINPQRLQQVRRQMPSLQHRVFV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctatctcgccgccgccattcaaatgaccagtcagccggatttagagaaaaat
ctcgctgccgctgaagagttgatcgaacttgccgtgggtaaaggggcggaattaatcggt
ttaccggagaatttcgcttttatgggggcagaaaccgataaaatcgcccaggccgagact
attgctcgaaaagccgataaattcctccgcaccatggcccaacggtttcaagtgaccatt
ttagggggtggttttcccgtgccggtgacgggtattcccgataaggcttataatacggct
attttagtcgatggcaacggtgcggaattagcccgttatcaaaaagtccatctctttgat
gtcaatgtcccggacggtaacacctatcaggaatcgagtacagtcatggcaggaatcgat
ttaccgccgatttatggctccgatagcttgggcaaaattggcctctcgatttgctatgat
gtgcgttttcccgaactctatcgctatttatcgcggcaaggagccgatgttttatttgta
cctgcggcgtttacagcttttacagggaaagatcattggaaagttttgttacaagcgcga
gcgatcgagaatacttgttatataatagctcctgctcaaacgggcaataattacgaacgc
cgttacacccacggtcacgctatgattatcgatccttggggtgtggttttagccgatgca
ggggaagaagcgggagtggcaattgccgaaattaatccccaacgtctgcaacaggtgcga
cgacaaatgccttctctgcagcatcgtgtttttgtttaa

DBGET integrated database retrieval system