KEGG   Mycoplasma wenyonii: WEN_03170Help
Entry
WEN_03170         CDS       T02179                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mwe  Mycoplasma wenyonii
Pathway
mwe00450  Selenocompound metabolism
mwe00970  Aminoacyl-tRNA biosynthesis
mwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mwe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    WEN_03170
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WEN_03170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mwe01007]
    WEN_03170
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mwe03016]
    WEN_03170
Enzymes [BR:mwe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     WEN_03170
Amino acid related enzymes [BR:mwe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   WEN_03170
Transfer RNA biogenesis [BR:mwe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    WEN_03170
 Prokaryotic type
   Other AARSs
    WEN_03170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AFN65413
UniProt: I6Z715
Position
595330..596814
Genome map
AA seq 494 aa AA seqDB search
MLTTPLFYASGDPHIGHAYTLLLASIAKKYFQLIGKKVYLLAGVDEHGEKILLKAQEEKL
EPQVFVDQVSQKFKNLNQALELSVDLFIRTSDQSHKEFVTDFFNNLVEKGNIYLSKWSGY
QCISCETNYSSKYFEKSNLCELGHQLIERAEESYFLKVKEFKDWFLTYYKENSIIFPEHY
RSNLESGIVSELEDLSVSRKNLSWGIQLSNSFCIYVWFDALLGYLSNEEIREKWKNKELK
IIQIIGKEIFKFHSIYFPLLLKAKELTLPSKLVVHGWLVNQKNRKISKSEASLIEKPLPK
ILEEFPLETLRWYCAYLNWGSDHTFSEEILKEYHNKYLLNLYGNLINRLKGILSKNNLTT
SQLEGGFTISEFSANFQLGTELLFQVKEKIENFEFYWIVNQVVTLLENANRLLEKFEPWK
LEVSSLEYQELNVLLYRQLVLASYLFSPIFSETKWKEIKESLSISSELDSDFLNTLSNFE
SVSLPKAHNLFIKY
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgctcactactcccctcttttatgcttctggagatccgcacattggtcacgcctacacc
ctattactagcctcgatagctaaaaagtattttcagttaataggcaagaaagtctattta
ctggcaggagtagatgaacacggggagaaaattctactcaaagctcaagaagagaaatta
gaacctcaagtatttgtagatcaagtaagtcagaaatttaaaaacttaaatcaagctctt
gagttatcagtagatctatttataagaacttctgatcaaagtcacaaagagtttgtcact
gatttttttaataacttagttgagaaaggaaatatctatctctctaagtgatctggttat
cagtgcattagttgtgaaactaattactcttctaagtactttgaaaagagcaatctttgt
gaattgggtcatcaactaattgaaagagctgaagagagttactttttaaaggtaaaagaa
ttcaaagattggttcttgacttactacaaagagaattcaattatctttccagagcactac
agaagtaatctagaaagtggaatagttagtgagttagaggatctttctgtttcaagaaag
aatctctcttgaggcattcaactatctaatagtttttgtatatatgtttgatttgatgct
ctgttaggttacttaagcaatgaagaaataagagagaagtgaaagaataaagaattaaag
attatccaaataattggaaaagagatatttaaatttcactctatttactttcctttactc
ttaaaagctaaagagcttactcttcctagtaaattagttgttcatggttgactagtaaat
caaaagaatagaaagatctctaaatctgaagcaagtttgattgaaaaacctttacccaag
atactagaggaatttcccctagaaactcttagatgatattgtgcctatctcaactgaggt
tcagatcacactttctcagaagaaatactcaaggaatatcacaataaatatctattgaat
ttgtatgggaacttaattaatagactcaagggaatactctccaaaaacaacttaactact
agtcagttagaggggggatttactatttcagagttctctgcaaactttcaactaggtact
gaattactctttcaagttaaagaaaagatagagaattttgagttctattgaatagtcaat
caagtcgttaccttacttgagaatgccaacagactgctggagaaatttgaaccttgaaag
ttagaggttagctccttagaatatcaagaactaaatgttttgttgtacaggcaactggta
ttggctagttacctattctctcctatcttcagtgagaccaagtgaaaagagatcaaagaa
tctttgagtatctcaagtgagttagactctgactttcttaacacactatctaactttgaa
agtgtctctctccctaaagctcataacttatttattaagtactaa

DBGET integrated database retrieval system