KEGG   Methanothermobacter wolfeii: MWSIV6_1551Help
Entry
MWSIV6_1551       CDS       T04587                                 

Gene name
mtrA1
Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit A 1 {ECO:0000255|HAMAP-Rule:MF_01093}
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mwo  Methanothermobacter wolfeii
Pathway
mwo00680  Methane metabolism
mwo01100  Metabolic pathways
mwo01120  Microbial metabolism in diverse environments
mwo01200  Carbon metabolism
Module
mwo_M00357  Methanogenesis, acetate => methane
mwo_M00567  Methanogenesis, CO2 => methane
mwo_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mwo00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MWSIV6_1551 (mtrA1)
Enzymes [BR:mwo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MWSIV6_1551 (mtrA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA MtrF
Motif
Other DBs
NCBI-ProteinID: SCM58298
UniProt: A0A1M4MTV5
Position
I:complement(1438914..1439630)
Genome map
AA seq 238 aa AA seqDB search
MVEKKSPAEGWPVVNGDYIVGDPESPVAATTLASHIEDVPVEAGAAIAGPCKTENLGIEK
MIANLISNPNIRFLILCGSEVQGHITGQSIEALHQNGVDPDKRNIIGATGAIPYIENIPD
EGIERFQKQLEIVNLIDVEDADAIKAKVKECIEKDPGAFEEEAMIIKVEEGGEEEEGEEV
KPVAPETALIEARMRNIQTQVKMIGSTNRMFAGMYSGKVQGIMIGLAFTLTLGILLLV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtggttgaaaagaaatcacctgctgaaggatggcccgtggttaacggggactacattgta
ggggaccctgaaagtccagtggctgccaccacccttgcctcacacatagaggacgttcca
gtagaagcaggcgctgcaatcgcagggccatgcaaaacagagaacctcggtattgaaaag
atgatcgccaacctcatatcaaaccccaacatcaggttcctcattctatgcggttcagag
gtccagggccacataacaggtcagagtatagaggccctccaccagaacggtgttgaccct
gataaaaggaacatcatcggtgcaaccggtgcaattccatacatagagaacatacctgat
gagggtattgagaggttccagaaacagctggaaattgtaaacctcattgacgttgaggac
gccgacgcaatcaaggccaaggtcaaggagtgcatcgagaaggacccaggggcattcgaa
gaagaggcaatgattataaaagtggaagaaggcggcgaagaagaagagggagaggaagtc
aaacctgtggctcctgaaacagcccttatagaggccaggatgaggaacatccagacacag
gttaagatgataggttccaccaacagaatgttcgccggtatgtactcaggtaaggttcag
ggcataatgatcggcctcgccttcaccctgacactgggtatacttctactggtctag

DBGET integrated database retrieval system