KEGG   Myxococcus xanthus: MXAN_0096Help
Entry
MXAN_0096         CDS       T00366                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_24 Methyltransf_12 Methyltransf_23 Ubie_methyltran MTS Methyltransf_9 Methyltransf_32 FtsJ PCMT Methyltransf_33 CMAS Methyltransf_4 Methyltransf_18 RrnaAD NodS TehB
Motif
Other DBs
NCBI-ProteinID: ABF87776
UniProt: Q1DG44
Position
complement(110594..111340)
Genome map
AA seq 248 aa AA seqDB search
MSEDAFFTVYGNLPRHGPGSDDCTREALRRLPPLPPHPRVVDLGCGAGAQTLVLAEALRT
RVIAVDLHEPFLDQLKARARERGLDALIDVQRQDMGALSLPEASFDLLWSEGAIYHLGFG
PGLRRWRPLLAPGGLAAVTECTWLTDERPDEIARFWGEVYPTMGTVLENRAAAETAGYEV
LDTFTLPASAWWDTYYTPLLQRVAHLRAHGDASLEDALSAAEQETRLYRQYEHTYGYVFH
LLRNPSAL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagacgccttcttcaccgtctatggcaacctgccccgtcacggccctggcagc
gacgactgcacccgggaggccctgcgacggctgcctccgctgccaccgcacccgcgcgtg
gtggacctcggctgtggcgcgggcgcgcagacgctggtgctcgccgaggcactgcgcacc
cgggtcatcgcggtggacctgcacgagcccttcctcgaccaactcaaggcacgagcgcgc
gagcggggcctggacgcgctcatcgacgttcagcggcaggacatgggcgcactgtcgctg
cccgaggcttcctttgacctcctctggtccgaaggcgccatctaccacctgggcttcggt
ccgggactgcggcgctggcgcccgctgctcgcgcccggcggcctggctgccgtcaccgaa
tgcacctggctgaccgatgagcgccccgacgaaatcgcgcgcttctggggtgaggtctac
cccaccatgggtacggttttggagaaccgcgccgccgcggaaaccgcgggctacgaggtg
ctcgacaccttcacccttcccgcctccgcatggtgggacacctactacacgcccctgctc
cagcgcgtcgcacacctgcgcgcccacggtgatgcgtcattggaagacgcgctctcggcc
gccgagcaggagacccgcctttatcgccagtacgaacacacctacggctacgtgttccat
ctgttacgcaacccgtcagcgctttga

DBGET integrated database retrieval system