KEGG   Myxococcus xanthus: MXAN_0100
Entry
MXAN_0100         CDS       T00366                                 
Name
(GenBank) peptidase, M28D (aminopeptidase ES-62) subfamily
Organism
mxa  Myxococcus xanthus
SSDB
Motif
Pfam: Peptidase_M28 Peptidase_M20 PA Peptidase_M42
Other DBs
NCBI-ProteinID: ABF91586
UniProt: Q1DG40
Position
114710..116215
AA seq 501 aa
MPVATFILPASLALQLLSAAAPAAKSAPKAVPAKPTVTAKRAAPVYAQATAEKLIGPALT
DGHAYARLAELTDGIGPRLSGSPGAEAAVQWALRSFKADGVKAWLEPVKVPHWVRGEASG
EVLASERTRGHPLALLALGGSPPTAPEGLTAEVVEVTSLEQLESLGAAVKGKFVFFNHTM
TVAADYGRFAGLRSRGPAAAAKHGAVGALVRSLATASLRTPHTGATNFPSEGPRIPAASV
ATEDADLLHRLLAGGPVRVKLMLGSSELPDADSSNVVAEIRGREKPQEIVLIGAHLDSWD
VGTGAHDDGAGVVMVMEAARLIAKLPQAPRRTVRVVLFMNEENGLRGGRAYAEAHAAELP
RHVGALEMDAGGGRPVSVSVRAGEGGQDLLRPWLPPLTALGVTQFSAREAGGADISPLMP
ARVPFFGVEVDSSRYFDVHHTEADTLDKVDPQDLARSTAAVAWMTYALAEMPGTLTRPEA
PAPRGPAPVTVPAQQSKTSGN
NT seq 1506 nt   +upstreamnt  +downstreamnt
ttgcccgtcgccaccttcatcctgcccgcttccctcgcgctccagttgctgtcggccgcc
gcacccgccgcgaagtcggcgcccaaggccgtccccgcgaagcccaccgtcaccgcgaag
cgtgccgcgcccgtgtacgcgcaggcgaccgcggagaagctcattgggcccgcgctcacg
gatggccatgcctatgcgcggctcgccgagctgacggacggcattggcccgcgcctgtcg
gggtcgccgggcgccgaggccgccgtgcagtgggcgctgcgttctttcaaggccgacggg
gtgaaggcgtggttggagccggtgaaggtgccgcactgggtgcgaggcgaggcgtccggc
gaggtgctggcctccgagcgcacgcgggggcaccccctggcgctgctggccctgggcggc
agcccgcccaccgcgcccgagggactcaccgccgaggtggtggaggtgacgtcgctggag
cagttggagtcgctgggcgcggcggtgaaggggaagttcgtcttcttcaaccacaccatg
acggtggccgcggactacgggcgcttcgcggggctgcgctcacgaggccccgccgccgcc
gcgaagcacggggcggtgggcgcgctggtgcgctcgcttgccacggcgtcgctgcgcacg
ccgcacacgggcgcgacgaacttccccagtgaggggccgcggattccggcggcgtcggtg
gccacggaggacgcggacctgctccaccggctgctggcgggcggcccggtgcgcgtgaag
ctgatgctgggcagttccgagctgccggacgcggattcctccaacgtcgtggcggagatt
cgcggccgggagaagccgcaggaaatcgtgctgattggcgcgcacctggattcgtgggac
gtgggcacgggcgcgcatgacgacggcgcgggcgtggtgatggtgatggaggccgcgcgc
ctcatcgcgaagctgccgcaggcgccccggcgcacggtgcgggtggtgctcttcatgaac
gaggagaacggcctgcgcggtgggcgcgcctacgcggaggcgcacgcggcggagttgccc
cggcacgtgggcgcgctggagatggacgcgggcggcgggcggcccgtgagcgtcagcgtg
cgcgcgggcgagggcgggcaggacctgctgcgcccgtggctgccgccgctgacggcgctg
ggggtgacgcagttctccgcgcgcgaggcgggtggggcggacatcagcccgctgatgccc
gcgcgcgtgcccttcttcggcgtggaggtggacagcagccgctacttcgacgtgcaccat
acggaggcggacacgctggacaaggtggacccgcaggacctggcgcgcagcaccgccgcc
gtggcgtggatgacgtacgcgctggcggagatgcccggcacgctcacgcgccccgaggcg
ccggcaccgcgtgggcccgcgccggtaaccgtgcccgcgcagcagtcgaagacctcaggg
aactaa

DBGET integrated database retrieval system