KEGG   Myxococcus xanthus: MXAN_0102Help
Entry
MXAN_0102         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorA
Motif
Other DBs
NCBI-ProteinID: ABF89119
UniProt: Q1DG38
Position
117468..118238
Genome map
AA seq 256 aa AA seqDB search
MTEQEQFEEILRELGELLLQLGDLSWNVVLIGGQVLALESLRKGGSGVIAVTTDTGAVIE
RGYSHEPDLLFDMDGTEFGAERLPEVLKLRGYERTRSFRWSKTLPGGVMHLDLFAPAGVD
LEQLPTSMTPLPDARLALRGSQPVFLPMGETSLRIRLPDAVGFLSMKVRAKLEQRPTETK
DCFDIFAYVKLVGLDDVRASLKQAGEEGQALRDKLQRLFWSTDAAGVLDIIAYAEGLEEV
DRALLAQAAVDLFADL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcaggagcagttcgaagagattctgcgagaactgggtgaactcctgctgcaa
ctgggagatctctcctggaacgtcgtgctcatcggcgggcaggtgctcgcgttggagtcg
ctccgcaagggtgggtcgggggtcatcgccgtcacgaccgacacaggcgccgtgattgag
cgcggctattcccacgagcctgatctgctcttcgacatggatggcaccgaattcggggcg
gagcgtctacctgaggtcctcaagctccgggggtacgagcgaacgcgcagttttcgttgg
tcgaaaacccttccgggaggggtgatgcacctcgacctgttcgcacctgctggagtcgat
ttggaacagctccccacgagcatgacgccgctgcctgatgcgcggttggcgctgcgtgga
agtcagccggtgtttctccccatgggagagacctcgctgcgaatccggctgccggacgca
gttggattcctctcgatgaaggttcgcgccaagttggagcagcggccaacggagaccaag
gactgcttcgatatctttgcctacgtcaagctcgtggggctggatgacgtgcgcgcatca
ctgaagcaggccggcgaggaagggcaggcgctccgtgacaaactgcagcgcttgttctgg
agcacggatgccgcaggtgtgctggatatcattgcctatgcagaaggactcgaggaggtc
gaccgggctttgcttgctcaggcggccgtcgacttgttcgccgatctctaa

DBGET integrated database retrieval system