KEGG   Myxococcus xanthus: MXAN_0121Help
Entry
MXAN_0121         CDS       T00366                                 

Gene name
mmsA
Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00280  Valine, leucine and isoleucine degradation
mxa00410  beta-Alanine metabolism
mxa00562  Inositol phosphate metabolism
mxa00640  Propanoate metabolism
mxa01100  Metabolic pathways
mxa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MXAN_0121 (mmsA)
   00562 Inositol phosphate metabolism
    MXAN_0121 (mmsA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MXAN_0121 (mmsA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MXAN_0121 (mmsA)
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     MXAN_0121 (mmsA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     MXAN_0121 (mmsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ABF91275
UniProt: Q1DG19
Position
142019..143503
Genome map
AA seq 494 aa AA seqDB search
MSFIQLPRSVVSCRNLVGGSWQVPPGAAHLDVRSPYTGTVIGRVPLTPASGVAQAVEAAK
AAAAAWKNTSLRERTQYLYRFRQFLERDLDALAQLAASEAGKTVAEARAGLLKGMEVCDF
ALSLQNLDTGAHLEVSRGISCEYRREPLGVVAGITPFNFPAMVPMWMFPIAVTLGNAFIL
KPSEKVPLTACALGELMCEAGYPAGVFSVVHGGKEAVDALVAHPDVQAVGFVGSSAVARH
LYAEGCKRGKRVLALGSAKNHLIVVPDADPELTPQAVVDSFTGCAGQRCMAASVLLAVGN
VESLLQEVVRRAAKLELGPGMGALIDRGSLDRLETAIARAEAEGARVLLDGRGHKPQGEP
WSGGNWLGPTLLDGVRPEMEAARRELFGPVLSIVRVPTLSAALAVENASPYGNAASIFTT
NGGVAQTVVEGVRAGMVGVNVGVPVPREPFSFGGTGDSRFGHGDITGPSSLDFWTQVKKV
TRKWSARTDGSWMS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgtccttcatccagcttccgcggagcgtcgtctcgtgccgtaacctcgttggaggaagc
tggcaggtgccgcccggtgcggcgcaccttgatgtccggagcccctacacgggcaccgtc
attggcagggttcccctgacgcccgcatccggagtcgcccaggcggtggaggccgcgaag
gcggcggcggctgcctggaagaacacctcgctgcgggagcgcacgcagtacctgtaccgc
ttccgccagttcctcgagcgtgacctggacgccctggcccagctggccgccagcgaggcg
gggaagacggtggcggaggcccgcgcgggcctgctcaagggcatggaggtctgcgacttc
gcgctgtccctccagaacctcgacacgggcgcgcacctggaggtcagccgcggcatctcc
tgtgagtaccgccgcgagccgctgggcgtcgtcgccggaatcactccgttcaacttcccg
gccatggtgccgatgtggatgttccccatcgccgtcacgctgggcaacgccttcatcctc
aagccgtcggagaaggtgccgctgaccgcgtgcgcgctgggcgagctcatgtgtgaggct
ggctaccccgcgggcgtcttctccgtcgtgcacggcggcaaggaggcggtggacgcgctg
gtggcgcacccggacgtgcaggcggtgggtttcgtcggctcgtccgcggtggcgcgccac
ctgtacgcggagggctgcaagcgcggcaagcgcgtgctggcgctgggcagcgcgaagaac
cacctcatcgtcgtgccggacgcggacccggagttgacgccgcaggcggtggtggactcg
ttcaccggctgcgcgggccagcgctgcatggcggccagcgtgctgctcgcggtgggcaac
gtggagtcccttctccaggaagtcgtccgccgcgcggcgaagctggaattgggccccggc
atgggcgcgctcatcgaccggggctcgttggaccgcttggagacggccattgcccgcgcg
gaggccgagggcgcgcgggtgctgctggacggccgtggccacaagccgcagggcgagccg
tggtccggcggcaactggctgggccccacgctgctggacggcgtgcgtccggagatggag
gccgcgcggcgcgagctgttcggcccggtgctctccatcgtccgggtgcccacgctgtcc
gcggcgctggcggtggagaacgcgtcgccctacggcaacgcggcgtccatcttcaccacg
aacggtggggtggcgcagacggtggtggagggcgtgcgcgccggcatggtgggcgtcaac
gtgggcgtccctgtcccgcgtgagccgttctccttcggtggcacgggcgattcgcgcttc
gggcacggggacatcaccgggccgtccagcctcgacttctggacgcaggtgaagaaggtc
acccgcaagtggtcggcccggaccgacggctcgtggatgagctga

DBGET integrated database retrieval system