KEGG   Myxococcus xanthus: MXAN_0124Help
Entry
MXAN_0124         CDS       T00366                                 

Gene name
upp
Definition
(GenBank) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00240  Pyrimidine metabolism
mxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MXAN_0124 (upp)
Enzymes [BR:mxa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     MXAN_0124 (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPRTase Pribosyltran
Motif
Other DBs
NCBI-ProteinID: ABF86250
UniProt: Q1DG16
Position
146048..146683
Genome map
AA seq 211 aa AA seqDB search
MEFPNCTVVDHPLVKHKLTQMRRVETSTASFRALLQEISLLLAYEALRDLKVREEDIQTP
MARTVAPVLDGKKLVLVAIMRAGQGILDGMLQLVPSARVGHIGLYRDPETLSPVEYYYRV
PGQLADRDVVVCDPMLATGNSAVAALQRLKKSKPGSLRFVCLLACPEGLTNLREHHPDVH
VYTAAIDERLDEHGYILPGLGDAGDRLFGTK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggagtttccgaactgcacggtggtggaccacccgctggtgaagcacaagctcacgcag
atgcgccgggtggagacgagcaccgcctcctttcgggcgctgctccaggaaatctcactg
ctgctcgcctatgaggcgctgagagacctcaaggtgcgcgaggaggacatccagacgccc
atggcacgcacggtggcgccggtgctggatggcaagaagttggtgctggtggccatcatg
cgcgcggggcagggcatcctcgacgggatgttgcaactggtgccctccgcgcgcgtgggg
cacatcggcctgtaccgagacccggagacgctgtcgccggtggagtactactaccgcgtg
cccggccagctcgcggaccgggacgtggtggtgtgcgacccgatgctcgccacggggaac
tcggcggtggccgcgctccagcggctgaagaagagcaagcccggctcattgcgcttcgtc
tgtctgctggcgtgcccggagggcctgacgaacctgcgcgagcaccacccggacgtccac
gtctacaccgccgccatcgacgagcgattggacgagcacggctacatcctcccgggcctg
ggcgacgcgggcgaccggctcttcgggaccaagtag

DBGET integrated database retrieval system