KEGG   Myxococcus xanthus: MXAN_0136Help
Entry
MXAN_0136         CDS       T00366                                 

Gene name
lnt
Definition
(GenBank) apolipoprotein N-acyltransferase
  KO
K03820  apolipoprotein N-acyltransferase [EC:2.3.1.269]
Organism
mxa  Myxococcus xanthus
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MXAN_0136 (lnt)
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.269  apolipoprotein N-acyltransferase
     MXAN_0136 (lnt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABF90513
UniProt: Q1DG04
Position
157990..159615
Genome map
AA seq 541 aa AA seqDB search
MTGVQVGVGRGWHLGAALLGVLGTTVLFALFGRLEARWLALGWVAMVPWLAALDRARSAR
EALSLGVLLSVTFTAAVFHWFPGALQAYSRAPTVVGWALFLLVAPLLQLQFVAAALARYA
ARRLAREGQGWLPPLVGTLVYVGVEGVTPKLFADTLGHGLYASEWLRQGADVAGAPGLTL
VLLLGNECVLAALRQSQRGLRAAWRPVAGLAALVLVLSGYGAFRHAQVREATRREGGLVV
GAVQANITRYEKLKAEMGAYEVVRMVLDTHYAMSDALLRDGPVDLLVWPETVYPTPFGAP
RSETGAALDAEIAGYVSERGVPLVFGTYDLEGEREFNAAMFLGPSSPGGAFERAAYRKTM
LFPLTEWVPDAIDTPTLREWLPWTGRWKRGPGPRAVSFTLRDGRQLRVAPLICYETIFPE
YVAQGVRQGAELLLTLSNDSWFTGTPAPRLHLMHAAFRSIETRRPQVRVTNSGVTALIDI
TGAVVAEVDDNQRAGLTMRVPETTALTTLALAWGDWLSPIALVSSVVGLAGAALARRRAR
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcgtccaggtgggggtgggacgcgggtggcacctgggagcggcgctgcttggt
gtcctggggaccacggtcctgttcgcgctgttcgggcggctggaggcgcgctggctggcg
ctcggctgggtggcgatggtgccctggctcgcggcgttggaccgggcccgctcggcacgc
gaggcgctgagcctgggcgtgctgctcagtgtgacgttcaccgccgccgtctttcactgg
ttcccgggcgcgctccaggcgtactcgcgggcgcccacggtggttggttgggcgctgttc
ctgctggtggcgccgctgctccagctccagttcgtcgccgccgcgctggcccggtacgcg
gcgcggcgtctggcgcgggaggggcagggctggttgccgcccctggtggggacgctcgta
tacgtgggtgtggagggcgtcacgcccaagctcttcgcggacacgttggggcatgggctc
tatgcctctgagtggctacgccagggcgcggacgtggcgggcgcgccgggactcacgctg
gtgttgctgctgggcaatgagtgcgtgctcgcggcgcttcgtcagtcacagcggggtttg
cgtgctgcctggcggcccgtggcagggctcgcggcgctggtgctcgtgttgtcggggtac
ggcgccttccggcatgcgcaggtgcgcgaggcaacccggcgtgagggcgggctggtggtg
ggcgcggtgcaggcgaacatcacccgctacgagaagctgaaggcggagatgggcgcctac
gaagtcgtgcggatggtgctcgacacgcactacgcgatgtcggacgcgctgctgcgcgac
ggaccggtggacctgttggtgtggccggagacggtgtaccccactccttttggagcgccg
cgcagcgagacgggcgcggcgctggacgcggagatcgccggctacgtctccgagcgcggg
gtgccgcttgtgttcggcacgtatgacctggagggcgagcgcgagttcaacgcggccatg
ttcctggggccgtcgtcacctggaggcgcgttcgagcgcgccgcgtaccgcaagacgatg
ctcttcccgctgacggagtgggtgccggacgccatcgacacccccacgcttcgcgagtgg
ctgccgtggacaggacgctggaagcgagggcccgggcctcgggcggtgagcttcacgctg
cgcgacggacgccagctccgggtggcgccgctcatctgctacgagaccatcttccccgag
tatgtcgcgcagggcgtgcggcagggcgcggagctgctgctcacgctgtccaacgactcg
tggttcaccggcacgcccgcgccccggttgcacctgatgcacgcggccttccgcagcatc
gagacgcggcggccacaggtccgggtgacgaactcgggtgtgaccgcgctcatcgacatc
acgggcgcggtggtggccgaggtggacgacaaccagcgcgcgggcctcaccatgcgcgtg
ccggagacgaccgcgctgacgacactcgccctggcgtggggagactggctgagcccaatt
gcgctggtgtcatcggtggtgggcctcgcgggtgcggcactggcgcggcggagggctcgg
ccctga

DBGET integrated database retrieval system