KEGG   Myxococcus xanthus: MXAN_0150Help
Entry
MXAN_0150         CDS       T00366                                 

Definition
(GenBank) conserved domain protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF90328
UniProt: Q1DFZ0
Position
complement(186938..187396)
Genome map
AA seq 152 aa AA seqDB search
MKRAPGRPAGAWADMCNGRGGGVQHARVASSLGPVATQGGNAMQAFNRWMVLGAVAVAMS
ITGCREQNREHQGTTTTPGMEGTGGSGQGTKPHPSGGTGGTGGSGHEMQGYDAGTGGSGH
EMQGYDAGMGGSGMMNDHNTKDTGTHSPEGQQ
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgggcccctggccgcccggccggagcatgggcggacatgtgcaacggtcggggg
ggcggggtgcaacacgcgagggtcgcctccagccttgggccagtcgctactcagggagga
aacgcgatgcaggctttcaatcggtggatggtgctcggtgcggtggcggtggcgatgtcc
attacaggatgcagggaacagaaccgtgagcaccaagggacgacgaccaccccgggcatg
gagggcaccggcggtagcggccagggcaccaagccgcaccctagcggcggcaccggcggc
accggcggctccggccacgagatgcaaggctacgacgccggcacgggcggctccggccac
gagatgcaaggctacgacgccggcatgggcggctccgggatgatgaacgaccacaacacc
aaggacaccgggacgcacagccccgaaggtcagcagtag

DBGET integrated database retrieval system