KEGG   Myxococcus xanthus: MXAN_0151Help
Entry
MXAN_0151         CDS       T00366                                 

Definition
(GenBank) putative methyltransferase
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 CMAS Methyltransf_23 Methyltransf_12 Methyltransf_31 MTS Methyltransf_15 Met_10
Motif
Other DBs
NCBI-ProteinID: ABF91861
UniProt: Q1DFY9
Position
complement(187417..188298)
Genome map
AA seq 293 aa AA seqDB search
MNAEAVQPEWRRDEVSAYYEAKTERLLQRYGPGPRVHYHSGLVDVVPPPGASSEVLRDTV
HSAQEALLMELARAVGRFPDGGEVVDVGCGLGGGALYWATEHQAHVTAVTNVPSHVALVR
GFAEAAGVSARVRPILCDALSVPGRAAFDAVVAVESACYLPRAEWFRRTRTLLKPGGVLA
IADCFLCRPELAPGFDRYWRTRIGSLDEYLSAAHAAGLELEVRDDVSSRVVGFWSLTLEL
MVHERASAHPTQHPLRALAQAGRGESSREHLRLQQALMDGGLEYGLLVLRRVD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgaagccgtgcaacccgagtggagacgcgacgaggtgagcgcgtactacgag
gcgaagacggagcggctgctccaacgctatgggcccggcccacgcgtgcactatcactcc
gggctggtggacgtggtgccgccgcccggcgcgtcctcggaggtgctgcgcgacacggtc
cattccgcgcaggaagcgctgctgatggagctggcgcgcgccgtgggccgcttcccggac
ggcggcgaggtggtggacgtcggctgtggcctgggcggcggcgcgctctactgggccacc
gagcatcaggcgcacgtgacggccgtgacgaacgtgccctcgcatgtcgcgctggtgcgc
ggcttcgcggaggccgcgggcgtgagcgcgcgcgtgcgccccatcctctgtgacgccctc
tccgtgccgggccgcgcggccttcgacgcggtggtggcggtggagagcgcctgctacctg
ccgcgcgccgagtggttccgccgcacgcggacgctgctgaagccaggcggcgtgctggcc
atcgccgactgcttcctctgccgtccggagctggcccctggctttgaccggtattggcgc
acgcgcatcggctcgctcgatgagtacctgtccgccgcgcacgccgcggggttggagctg
gaggtccgcgacgacgtgtcctcacgcgtggtgggcttctggtcgctgacactggaattg
atggtgcatgagcgcgcttcggcacaccccacccagcatcccctgcgtgcgctcgctcag
gccggccgcggcgaatccagccgcgagcacctgcgcctgcagcaggcgttgatggacggc
ggtctggagtacgggctgctcgtgctccggcgggtggactga

DBGET integrated database retrieval system