KEGG   Myxococcus xanthus: MXAN_0161Help
Entry
MXAN_0161         CDS       T00366                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405
Motif
Other DBs
NCBI-ProteinID: ABF86553
UniProt: Q1DFX9
Position
complement(195530..196189)
Genome map
AA seq 219 aa AA seqDB search
MQAPERRRPQPWLIRVTHWLNVPLLLIMAASGLQILVAYPMLGPQGRPYGWYPYQGIPPP
EWMRLGNWLAGARHWHFAFAWFLILNGVAYVLYLALSGEWRRRLFLPRRDTRNALDTLAF
YLRVRKHAPAQGLYNGLQRLAYTGTLALGLLAVLSGLVLYKPVQFGALTSLLGGYDAARA
IHLVILALLALFTVGHITLVLLHPRSLAEMVTGGRKPDA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcccctgaacgacgcaggcctcagccgtggctcatccgagtcacccactggctc
aacgtaccgctgctgctcatcatggcggccagcggactccagatacttgtcgcctatccc
atgctcggaccacagggccggccctacggctggtatccctaccagggcatccctccaccc
gaatggatgcggctggggaactggctggccggcgcccgtcactggcacttcgccttcgcg
tggttcctcatcctcaacggcgtggcgtacgtgctctacctcgccctcagcggtgagtgg
cgccgccgcctcttcctgccccgccgcgacacacgcaacgccctggacacgctcgccttc
tacctgcgcgtgcgaaaacacgcgcccgcgcaggggctctacaacggccttcagcggctg
gcgtacacgggcacgctggcgctgggactgctcgcggtgctctccgggctggtcctctac
aagcccgtgcagttcggcgcgctcacttcgctgctaggtggctacgacgcggcgcgcgcc
atccacctcgtcatcctggcgctgctcgccctgttcaccgtgggccacatcaccctggtg
ctgctccacccgcgaagcctggcggagatggtgacgggcggaaggaagccggatgcctag

DBGET integrated database retrieval system