KEGG   Myxococcus xanthus: MXAN_0167Help
Entry
MXAN_0167         CDS       T00366                                 

Definition
(GenBank) osmosensitive K+ channel His kinase sensor domain/universal stress domain protein
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
mxa  Myxococcus xanthus
Pathway
mxa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MXAN_0167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mxa01001]
    MXAN_0167
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mxa02022]
    MXAN_0167
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     MXAN_0167
Protein kinases [BR:mxa01001]
 Histidine kinases
  OmpR family
   MXAN_0167
Two-component system [BR:mxa02022]
 OmpR family
  KdpD-KdpE [MD:M00454]
   MXAN_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpD Usp DNA_photolyase AAA_30 PEGSRP
Motif
Other DBs
NCBI-ProteinID: ABF89157
UniProt: Q1DFX3
Position
202310..203479
Genome map
AA seq 389 aa AA seqDB search
MTMTRRSRAEDFLELVERGRRGRLKLYIGFAAGVGKTYRMLEEAHALKRRGVDVVLGFVE
SHDRADTQALVEGLEVVPRKQYSYRDVTVEEMDLDAVLARKPQVAVVDELAHTNLPVCRH
RKRYQDVQALLDAGINVIGAFNVQHLESLNDLVERATGVAVRETLPDSFLKAADQVVNLD
LAVEDLHERLRTGKIYAKDKVPRALERFFTEENLATLRELALREVAESLDRATARPPPGE
GDEGSQRSAAWGRVLVALSSYPRHAATLMRRGSRMAGRLNTDWFVVYVETPREAPHLIDA
EAQRHLLTNIEKAKELGAEVVRLRARDPVEGILDFARSHGVGHIIVGRSHQPWWKQRLGR
AVDMRLVREGRGFDIHVVAFEPREEGRRP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgacgcggcgctcacgcgcggaggacttcctggagctggtggagcggggcagg
cgtggccggctcaagctctacatcggcttcgcggccggggtggggaagacgtaccggatg
ctggaggaggcacacgcgctgaagcggcgcggcgtggacgtggtgctgggcttcgtggag
tcgcatgaccgcgcggacacgcaggcgctggtggagggcctggaggtggtgccgcgcaag
cagtactcctaccgcgacgttaccgtggaggagatggacctggacgcggtgctcgcgcgc
aagccccaggtggcggtggtggacgagctggctcacaccaaccttccggtgtgccgccac
cgcaagcgctatcaggacgtgcaggcgttgctggacgcgggcatcaacgtcatcggggcc
ttcaacgtccagcacctggagagcctcaacgatttggtggagcgcgccaccggcgtcgcc
gtgcgggagacactgcccgacagcttcctcaaggccgccgaccaggtggtgaacctggac
ctggcggtggaggacctgcacgagcggctccggacggggaagatctacgcgaaggacaag
gtgccgcgggcgctggagcgcttcttcacggaggagaacctggccacgctgcgcgagctg
gcgctgcgtgaggtggcggagagcctggaccgcgccaccgcgaggccgcctccgggagag
ggagatgaaggttcgcagcggagcgcggcctggggccgggtgctggtggcgctgtccagt
tatccccggcacgcggcgacgctgatgcgccggggctcacggatggcgggccggctgaac
acggactggttcgtcgtgtacgtggagacgccgcgcgaggcgccgcacctcatcgacgcg
gaggcgcagcggcatctgctgacgaacatcgagaaggcgaaggagctgggcgcggaggtg
gtgcgcctgagggctcgagacccggtggagggcatcctggacttcgcgcgctcgcacggc
gtgggtcacatcatcgtcggccgttcgcatcagccgtggtggaagcagcggctggggcgc
gcggtggacatgaggctggttcgtgaaggccggggcttcgacatccacgtggtggccttc
gagccgcgcgaggagggacgccgcccatga

DBGET integrated database retrieval system